DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and LOC110438249

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:231 Identity:83/231 - (35%)
Similarity:132/231 - (57%) Gaps:6/231 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PRKLNRLYCVYNCVTAPFLRLAPIKTEILSVDPFVILLHDMVSHKEGALIRSSSKNQILPSETVN 360
            |::..:|.|.|.......|.|  .|.|:....|.::..||.:|..|...|::.::.::..::.::
Zfish     3 PQRERKLVCRYRRGRGNPLML--FKEEVEWDQPMILRYHDFLSEGEIDTIKTLARPKLSRAQVID 65

  Fly   361 AANEFEI-AKFRTSKSVWFDSDANEATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFESHFDT 424
            |.:...: |..|.|:|.|...|.:....::.||:.:.|||:::.:|..|:.||||||.:|.|:|:
Zfish    66 AVSGKRVSAASRVSQSAWLYEDEDPVVTQVNQRIADVTGLELQTAESLQIANYGIGGQYEPHYDS 130

  Fly   425 SLADEDRF-VNGYIDRLATTLFYLNDVPQGGATHFPGLNITVFPKFGTVLMWYNLHTEGMLHVRT 488
            .|.::..| :.|  .|:||.|.|::||..||||.||.:...:.||.|:.::|:||...|...:||
Zfish   131 KLTNDSDFQLRG--GRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNLLRNGNEDIRT 193

  Fly   489 MHTGCPVIVGSKWVVSKWIDDKGQEFRRPCLRSRLD 524
            :|..|||.||||||.:|||...||||||.|...:.|
Zfish   194 LHAACPVFVGSKWVANKWIRTYGQEFRRKCSTIKSD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 61/168 (36%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 68/191 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.