DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or82a and Or33a

DIOPT Version :9

Sequence 1:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:386 Identity:82/386 - (21%)
Similarity:158/386 - (40%) Gaps:78/386 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ISAQYPLISYVAYNRNDMEKVTACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASH 105
            :...||....|.:.      :|:.::::|       .:...|...|.  ..|..||.:|..|...
  Fly    25 VEGDYPFRRLVDFT------ITSFITILF-------PVHLILGMYKK--PQIQVFRSLHFTSECL 74

  Fly   106 IPRYR--------------EG----LDYVAEA-----------NKLASFLGRAYCV-------SC 134
            ...|:              ||    ||...|:           :::|..|.::|.|       :.
  Fly    75 FCSYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRVARMLSKSYLVAAISAIITA 139

  Fly   135 GLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFPFNDLESPG--YEVCFLYTVLVTVVVVAYA 197
            .:.||:.....::.:|   |              ||: |.::..  |.:.|.|..:.:.:::...
  Fly   140 TVAGLFSTGRNLMYLG---W--------------FPY-DFQATAAIYWISFSYQAIGSSLLILEN 186

  Fly   198 SAVDGL-FISFAI---NLRAHFQTLQRQIENWEFPSSEPDTQIRLKSIVEYHVLLLSLSRKLRSI 258
            .|.|.. .|:|.:   ::|.....|.|...:.:..||| :|:..::.|.: |..|:.:.|.|||.
  Fly   187 LANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSE-NTRKLIEGIQD-HRKLMKIIRLLRST 249

  Fly   259 YTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYASFFGSIMLQLFIYCYGGEIIKAESLQVD 323
            ...:.:|||:.:.:.:.:.:..::...::...:|.||.||.:::::||..||.|.::..|..::.
  Fly   250 LHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLP 314

  Fly   324 TAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAGFFVA-SLANFVGICRTALSLITLIKS 383
            .|:..|||.....:...||.:::..:...|.|:||..|. .::.|....|.|.|..||..|
  Fly   315 YAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTLALS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 73/351 (21%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 70/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.