DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and MPK2

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_564746.1 Gene:MPK2 / 842248 AraportID:AT1G59580 Length:376 Species:Arabidopsis thaliana


Alignment Length:351 Identity:128/351 - (36%)
Similarity:205/351 - (58%) Gaps:37/351 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ESIFDVR------KRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFR 80
            :::|::.      |.:|:||||:|..:.:|.:...||:||:.:.|.:..||.||.||:..||..|
plant    23 QTLFEIDTKYVPIKPIGRGAYGVVCSSVNRESNERVAIKKIHNVFENRIDALRTLRELKLLRHLR 87

  Fly    81 CHPNIVRLVDIFKASNNLDF---YLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFIHS 142
             |.|:|.|.|:..|::...|   |||:|.|::|||.:||...||.:.|.::.::||:..:|:|||
plant    88 -HENVVALKDVMMANHKRSFKDVYLVYELMDTDLHQIIKSSQVLSNDHCQYFLFQLLRGLKYIHS 151

  Fly   143 GNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPEILVAS 207
            .|::||||||.|:|:::.|.||:.|||||||.:::..:        :|:||.||||||||:|:..
plant   152 ANILHRDLKPGNLLVNANCDLKICDFGLARTSNTKGQF--------MTEYVVTRWYRAPELLLCC 208

  Fly   208 RNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASI-GPS----FGSV 267
            .||...||:|.:|||..|::.:||:|.||..:|||:.|:..|.:..:.|:..| .|.    ..|:
plant   209 DNYGTSIDVWSVGCIFAELLGRKPVFPGTECLNQIKLIINILGSQREEDLEFIDNPKAKRYIESL 273

  Fly   268 LLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYASAEMDLH 332
            ..|..|...|.|....::      .|.|::.:|||:|..|::..||::|||::.....||.    
plant   274 PYSPGISFSRLYPGANVL------AIDLLQKMLVLDPSKRISVTEALQHPYMAPLYDPSAN---- 328

  Fly   333 MDVVPPLKDHVRYDVDQYRNSLYELI 358
                ||.:..:..|||:..:...|:|
plant   329 ----PPAQVPIDLDVDEDEDLGAEMI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 127/349 (36%)
MPK2NP_564746.1 STKc_TEY_MAPK 26..363 CDD:143363 128/348 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.