DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and MPK11

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_001117210.1 Gene:MPK11 / 839523 AraportID:AT1G01560 Length:369 Species:Arabidopsis thaliana


Alignment Length:361 Identity:132/361 - (36%)
Similarity:204/361 - (56%) Gaps:48/361 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SIFDVRKR-------MGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFR 80
            ::|:|.|:       :|:||.|||..|.:..|...||:||:.:||.:..||:||.||:..|:...
plant    31 NLFEVSKKYVPPLRPIGRGASGIVCAAWNSETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMD 95

  Fly    81 CHPNIVRLVDIFK---ASNNLDFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFIHS 142
             |.|::.::||.:   ..|..|.::|:|.|::|||::|:....|.|.|.||.:|||:..:|::||
plant    96 -HDNVIAIIDIIRPPQPDNFNDVHIVYELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHS 159

  Fly   143 GNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPEILVAS 207
            .||:||||||||:|:::.|.||:.|||||||.|        |.| .:|:||.||||||||:|:..
plant   160 ANVLHRDLKPSNLLLNANCDLKIGDFGLARTKS--------ETD-FMTEYVVTRWYRAPELLLNC 215

  Fly   208 RNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASIGPSFGSVLLSRN 272
            ..||..||:|.:||||||::.::|||.|...|.|: :::|.|  :...|.:|:|     .|.|.|
plant   216 SEYTAAIDIWSVGCILGEIMTREPLFPGRDYVQQL-RLITEL--IGSPDDSSLG-----FLRSDN 272

  Fly   273 IQR-------DRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYASAE-- 328
            .:|       ..|.:......|...:.:.|::.:||.:|:.|:|..||:.|||::.....:.|  
plant   273 ARRYVRQLPQYPRQNFAARFPNMSVNAVDLLQKMLVFDPNRRITVDEALCHPYLAPLHEYNEEPV 337

  Fly   329 --MDLHMDVVPPLKDHVRYDVDQYRNSLYELIDRET 362
              ...|.|...|         .....::.|||.||:
plant   338 CVRPFHFDFEQP---------SLTEENIKELIYRES 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 128/355 (36%)
MPK11NP_001117210.1 STKc_TEY_MAPK 33..369 CDD:143363 132/359 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.