DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and AT4G01595

DIOPT Version :10

Sequence 1:NP_727335.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_680555.2 Gene:AT4G01595 / 828086 AraportID:AT4G01595 Length:140 Species:Arabidopsis thaliana


Alignment Length:79 Identity:30/79 - (37%)
Similarity:41/79 - (51%) Gaps:16/79 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 YTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASIGPSFGSVLLSRNIQ 274
            ||..||:|.:|||..|::..||||.|.|.|:|:| ::|.|....|.|..|            .::
plant    20 YTPAIDVWSIGCIFAEVLTWKPLFPGKSVVHQLE-LITDLLGTPKSDAIS------------GVR 71

  Fly   275 RD--RRYSLDEMMK 286
            .|  |:| |.||.|
plant    72 NDKARKY-LTEMRK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_727335.1 STKc_MAPK15-like 17..358 CDD:270841 30/79 (38%)
AT4G01595NP_680555.2 Protein Kinases, catalytic domain <20..118 CDD:473864 30/79 (38%)

Return to query results.
Submit another query.