DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and MPK6

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_181907.1 Gene:MPK6 / 818982 AraportID:AT2G43790 Length:395 Species:Arabidopsis thaliana


Alignment Length:368 Identity:130/368 - (35%)
Similarity:201/368 - (54%) Gaps:55/368 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SIFDVRKR-------MGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFR 80
            :||:|..:       :||||||||..|.:..|..:||:||:.:||.::.||:||.||:..||...
plant    54 NIFEVTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD 118

  Fly    81 CHPNIVRLVDIF-----KASNNLDFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFI 140
             |.|||.:.||.     .|.|  |.|:.:|.|::|||.:|:....|.:.|.::.:||::..:|:|
plant   119 -HENIVAIRDIIPPPLRNAFN--DVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYI 180

  Fly   141 HSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPEILV 205
            ||.||:||||||||:|:::.|.||:.||||||..|        |.| .:|:||.||||||||:|:
plant   181 HSANVLHRDLKPSNLLLNANCDLKICDFGLARVTS--------ESD-FMTEYVVTRWYRAPELLL 236

  Fly   206 ASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSL--PNVTKLDIASIGPSFGSVL 268
            .|.:||..||:|.:|||..|::.:||||.|...|:|:..::..:  |:..:|:           .
plant   237 NSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELE-----------F 290

  Fly   269 LSRNIQR-------DRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYAS 326
            |:.|.:|       ..|.|:.:.........|.|::.:|..:|..|:|..:|:.|||::.....|
plant   291 LNENAKRYIRQLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDIS 355

  Fly   327 AEMDLHMDVVPPLKDHVRYDVDQY---RNSLYELIDRETSCSN 366
            .|.:.   .:|     ..:|.:.:   ...:.|||.||....|
plant   356 DEPEC---TIP-----FNFDFENHALSEEQMKELIYREALAFN 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 125/358 (35%)
MPK6NP_181907.1 STKc_TEY_MAPK 56..391 CDD:143363 129/366 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.