DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and MPK7

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_179409.1 Gene:MPK7 / 816330 AraportID:AT2G18170 Length:368 Species:Arabidopsis thaliana


Alignment Length:355 Identity:125/355 - (35%)
Similarity:199/355 - (56%) Gaps:42/355 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ESIFDVR------KRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFR 80
            :::|::.      |.:|:||||:|..:.:|.|...||:||:.:.|.:..||.||.||:..||..|
plant    23 QTLFEIDTKYVPIKPIGRGAYGVVCSSINRETNERVAIKKIHNVFENRVDALRTLRELKLLRHVR 87

  Fly    81 CHPNIVRLVDIFKASNNLDF---YLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFIHS 142
             |.|::.|.|:...:|...|   |||:|.|::|||.:||....|.|.|.::.::||:..:|::||
plant    88 -HENVIALKDVMLPANRSSFKDVYLVYELMDTDLHQIIKSSQSLSDDHCKYFLFQLLRGLKYLHS 151

  Fly   143 GNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPEILVAS 207
            .|::||||||.|:|:::.|.||:.|||||||....      ||  .:|:||.||||||||:|:..
plant   152 ANILHRDLKPGNLLVNANCDLKICDFGLARTSQGN------EQ--FMTEYVVTRWYRAPELLLCC 208

  Fly   208 RNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASI-GPSFGSVLLSR 271
            .||...||:|.:|||..|::.:||:|.||..:||::.|:..:.:..:.||..| .|.      :|
plant   209 DNYGTSIDVWSVGCIFAEILGRKPIFPGTECLNQLKLIINVVGSQQESDIRFIDNPK------AR 267

  Fly   272 NIQRDRRYSLDEMMKNCCDD----GISLVKALLVLNPHNRLTAKEAIRHPYVS-RFQYASAEMDL 331
            ...:...||....:.|....    .|.|::.:||.:|..|::..:|:.|||:: .|...|.    
plant   268 RFIKSLPYSRGTHLSNLYPQANPLAIDLLQRMLVFDPTKRISVTDALLHPYMAGLFDPGSN---- 328

  Fly   332 HMDVVPPLKDHVRYDVDQYRNSLYELIDRE 361
                 ||....:..|:|:   ::.|.:.||
plant   329 -----PPAHVPISLDIDE---NMEEPVIRE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 123/350 (35%)
MPK7NP_179409.1 STKc_TEY_MAPK 26..361 CDD:143363 125/352 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.