DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and Mapk11

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:XP_017450608.1 Gene:Mapk11 / 689314 RGDID:1309340 Length:371 Species:Rattus norvegicus


Alignment Length:335 Identity:118/335 - (35%)
Similarity:187/335 - (55%) Gaps:54/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QELDQTVESIFDVRKRM------GKGAYGIVW-------KATDRRTKNTVALKKVFDAFRDETDA 66
            |||::||   ::|.:|:      |.||||.||       .|.|.|.:..||:||:...|:....|
  Rat    11 QELNKTV---WEVPQRLQGLRPVGSGAYGSVWSHPGPPHSAYDARLRQKVAVKKLSRPFQSLIHA 72

  Fly    67 QRTYREVIFLRAFRCHPNIVRLVDIFKASNNL-DF---YLVFEFMESDLHNVIKRGNVLKDVHKR 127
            :|||||:..|:..: |.|::.|:|:|..:.:: ||   |||...|.:||:|::| ...|.|.|.:
  Rat    73 RRTYRELRLLKHLK-HENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVK-CQALSDEHVQ 135

  Fly   128 FVMYQLINAIKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDY 192
            |::|||:..:|:|||..:|||||||||:.::..|.|::.||||||           :.|..:|.|
  Rat   136 FLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLAR-----------QADEEMTGY 189

  Fly   193 VATRWYRAPEILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDI 257
            |||||||||||::...:|.:.:|:|.:|||:.|:::.|.||.|...::|:::|           :
  Rat   190 VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRI-----------M 243

  Fly   258 ASIGPSFGSVLLSRNIQRDRRY--SLDEMMKNCCDD--------GISLVKALLVLNPHNRLTAKE 312
            ..:|.....||...:.:..|.|  ||..|.:.....        .:.|:..:|||:...|::|.|
  Rat   244 EVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAVDLLGRMLVLDSDQRVSAAE 308

  Fly   313 AIRHPYVSRF 322
            |:.|.|.|::
  Rat   309 ALAHAYFSQY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 116/333 (35%)
Mapk11XP_017450608.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.