DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and Mapk12

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_068514.1 Gene:Mapk12 / 60352 RGDID:70975 Length:367 Species:Rattus norvegicus


Alignment Length:334 Identity:116/334 - (34%)
Similarity:179/334 - (53%) Gaps:67/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QELDQT---VESIFDVRKRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFL 76
            ||:.:|   |.:::...:.:|.||||.|..|.|.||.|.||:||::..|:.|..|:|.|||:..|
  Rat    14 QEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYRPFQSELFAKRAYRELRLL 78

  Fly    77 RAFRCHPNIVRLVDIFKASNNL----DFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAI 137
            :..| |.|::.|:|:|.....|    |||||..||.:||..::|...:.:| ..:|::||::..:
  Rat    79 KHMR-HENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHETLSED-RIQFLVYQMLKGL 141

  Fly   138 KFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPE 202
            |:||:..||||||||.|:.::..|.||:.||||||           :.|..:|.||.||||||||
  Rat   142 KYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLAR-----------QADSEMTGYVVTRWYRAPE 195

  Fly   203 ILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKI---------------------- 245
            :::....||:.:|:|.:|||:.|||..|.||:|...::|:::|                      
  Rat   196 VILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMKVTGTPPPEFVQKLQSAEAKN 260

  Fly   246 -VTSLPNVTKLDIASIGPSFGSVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLT 309
             :..||.:.|.|.||:                        :.|.....::|::.:|||:...|:|
  Rat   261 YMEGLPELEKKDFASV------------------------LTNASPQAVNLLEKMLVLDAEQRVT 301

  Fly   310 AKEAIRHPY 318
            |.||:.|||
  Rat   302 AAEALAHPY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 114/332 (34%)
Mapk12NP_068514.1 STKc_p38gamma 11..353 CDD:143385 116/334 (35%)
TXY 183..185 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.