DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and MAPK13

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_002745.1 Gene:MAPK13 / 5603 HGNCID:6875 Length:365 Species:Homo sapiens


Alignment Length:376 Identity:119/376 - (31%)
Similarity:201/376 - (53%) Gaps:51/376 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELDQTVESIFDVRKRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFR 80
            ||.:|..|    ...:|.||||.|..|.|:|:...||:||:...|:.|..|:|.|||::.|:..:
Human    20 ELPKTYVS----PTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQ 80

  Fly    81 CHPNIVRLVDIFKASNNL----DFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFIH 141
             |.|::.|:|:|..:::|    |||||..||::||..::  |....:...::::||::..:|:||
Human    81 -HENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIM--GMEFSEEKIQYLVYQMLKGLKYIH 142

  Fly   142 SGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPEILVA 206
            |..|:||||||.|:.::..|.||:.||||||           ..|..:|.||.||||||||::::
Human   143 SAGVVHRDLKPGNLAVNEDCELKILDFGLAR-----------HADAEMTGYVVTRWYRAPEVILS 196

  Fly   207 SRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKI--VTSLPN---VTKLDIASIGPSFGS 266
            ..:|.:.:|:|.:|||:.||:..|.||:|...::|:.:|  ||.:|.   |.||: .....|:  
Human   197 WMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLN-DKAAKSY-- 258

  Fly   267 VLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYASAEMDL 331
               .:::.:..|....::..........|::.:|.|:...||||.:|:.||:...|:....|.:.
Human   259 ---IQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEA 320

  Fly   332 HMDVVPPLKD---HVRYDVDQYRNSLYELIDRETSCSNRTVSNSTPSSNRD 379
            ..    |..|   |.:..||:::..:|           :.:.|.:|.:.:|
Human   321 QQ----PFDDSLEHEKLTVDEWKQHIY-----------KEIVNFSPIARKD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 115/352 (33%)
MAPK13NP_002745.1 STKc_p38delta 9..351 CDD:143384 117/369 (32%)
TXY 180..182 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.