DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and MAPK9

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_001351537.1 Gene:MAPK9 / 5601 HGNCID:6886 Length:424 Species:Homo sapiens


Alignment Length:435 Identity:139/435 - (31%)
Similarity:222/435 - (51%) Gaps:75/435 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QTVESIFDVRKR------MGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLR 77
            |..:|.|.|.||      :|.||.|||..|.|......||:||:...|:::|.|:|.|||::.|:
Human    14 QVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLK 78

  Fly    78 AFRCHPNIVRLVDIFKASNNL----DFYLVFEFMESDLHNVIKRGNVLKDVHKR--FVMYQLINA 136
            ... |.||:.|:::|.....|    |.|||.|.|:::|..||.    ::..|:|  :::||::..
Human    79 CVN-HKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH----MELDHERMSYLLYQMLCG 138

  Fly   137 IKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAP 201
            ||.:||..:||||||||||::.|.|.||:.|||||||..:         :.|:|.||.||:||||
Human   139 IKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACT---------NFMMTPYVVTRYYRAP 194

  Fly   202 EILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASIGPSFGS 266
            |::: ...|.:.:|:|.:|||:||:::...:||||..::|..|::..|...:...:..:.|:.  
Human   195 EVIL-GMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTV-- 256

  Fly   267 VLLSRNIQRDR-RY---------------SLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIR 315
                ||...:| :|               |..|..|........|:..:||::|..|::..||:|
Human   257 ----RNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALR 317

  Fly   316 HPYVSRFQYASAEMDLHMDVVPPLK------DHVRYDVDQYRNSLY-ELIDRETSCSNRTV---- 369
            |||::.: |..||.:     .||.:      :...:.:::::..:| |::|.|....|..|    
Human   318 HPYITVW-YDPAEAE-----APPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQP 376

  Fly   370 ------SNSTP---SSNRDELPKPVRVTKQARTTSAKQPTTSPAE 405
                  ||:||   ||..|........|..:.|.|:...:|.|.|
Human   377 SDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 122/373 (33%)
MAPK9NP_001351537.1 STKc_JNK 25..360 CDD:270840 116/361 (32%)
TXY 183..185 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..424 15/54 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.