DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and MAPK3

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_002737.2 Gene:MAPK3 / 5595 HGNCID:6877 Length:379 Species:Homo sapiens


Alignment Length:390 Identity:135/390 - (34%)
Similarity:199/390 - (51%) Gaps:89/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELDQTVESIFDVRKR------MGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVI 74
            |::......|||..|      :|:||||:|..|.|...|..||:||: ..|..:|..|||.||:.
Human    27 EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKI-SPFEHQTYCQRTLREIQ 90

  Fly    75 FLRAFRCHPNIVRLVDIFKASN---NLDFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINA 136
            .|..|| |.|::.:.||.:||.   ..|.|:|.:.||:||:.::|...:..| |..:.:||::..
Human    91 ILLRFR-HENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSND-HICYFLYQILRG 153

  Fly   137 IKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQD--GMLTDYVATRWYR 199
            :|:|||.||:||||||||:||::.|.||:.||||||..       |.|.|  |.||:||||||||
Human   154 LKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIA-------DPEHDHTGFLTEYVATRWYR 211

  Fly   200 APEILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKI------------------- 245
            ||||::.|:.|||.||:|.:||||.||:..:|:|.|...::|:..|                   
Human   212 APEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMK 276

  Fly   246 ----VTSLPNVTKLDIASIGPSFGSVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHN 306
                :.|||:.||:..|.:.|...|                        ..:.|:..:|..||:.
Human   277 ARNYLQSLPSKTKVAWAKLFPKSDS------------------------KALDLLDRMLTFNPNK 317

  Fly   307 RLTAKEAIRHPYVSRFQYASAE--------MDLHMDVVPPLKDHVRYDVDQYRNSLYELIDRETS 363
            |:|.:||:.|||:.::...:.|        ..:.:|.:|             :..|.|||.:||:
Human   318 RITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLP-------------KERLKELIFQETA 369

  Fly   364  363
            Human   370  369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 130/382 (34%)
MAPK3NP_002737.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
STKc_ERK1_2_like 36..370 CDD:270839 134/381 (35%)
TXY 202..204 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.