powered by:
Protein Alignment Erk7 and LOC365949
DIOPT Version :9
Sequence 1: | NP_001188568.1 |
Gene: | Erk7 / 31877 |
FlyBaseID: | FBgn0052703 |
Length: | 916 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017446840.1 |
Gene: | LOC365949 / 365949 |
RGDID: | 1590827 |
Length: | 194 |
Species: | Rattus norvegicus |
Alignment Length: | 36 |
Identity: | 13/36 - (36%) |
Similarity: | 24/36 - (66%) |
Gaps: | 2/36 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 291 DGISLVKALLVLNPHNRLTAKEAIRHPYV--SRFQY 324
:.:.|:..:||.:|..|::||:|:.|||: .|.:|
Rat 35 EAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRY 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Erk7 | NP_001188568.1 |
STKc_MAPK15-like |
17..358 |
CDD:270841 |
13/36 (36%) |
LOC365949 | XP_017446840.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D741207at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.