DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and F09C12.2

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_872069.1 Gene:F09C12.2 / 353395 WormBaseID:WBGene00017277 Length:418 Species:Caenorhabditis elegans


Alignment Length:339 Identity:101/339 - (29%)
Similarity:179/339 - (52%) Gaps:42/339 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RKRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFRCHPNIVRLVDIF 92
            ::.:|.||:|:|.:|.|.:....||:||:...|::::.|:...||:...|.. .|.||:...|:.
 Worm    47 QENLGAGAFGVVCRAIDSKLNKQVAIKKITRVFKNQSTAKCALREIRITREL-SHENIINSTDVL 110

  Fly    93 --KASNNLDFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFIHSGNVIHRDLKPSNI 155
              ::.:..|.|:|.:.||:||.:|:|....|.:.|.::..||::..:|::||..:|||||||:|:
 Worm   111 MRESGSGQDIYIVMDLMETDLLSVLKSNQTLNEKHFQYFFYQILKGLKYLHSAGIIHRDLKPANL 175

  Fly   156 LIDSKCRLKVADFGLARTLSSRRIYDDLEQD----GMLTDYVATRWYRAPEILVASRNYTKGIDM 216
            |::..|.||:||||::|:..|.:...:...:    |.|:.||:|.||||||||::...|...:|:
 Worm   176 LLNEDCSLKIADFGMSRSGPSTKTTPNTSPNAHISGDLSQYVSTLWYRAPEILLSMGEYDTQVDI 240

  Fly   217 WGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSL-------------PNVTKLDIASIGPSFGSVL 268
            |..||||.||:..:|:|.||.:.:||:.::..|             |::... |:|.||.     
 Worm   241 WSAGCILAEMLLLRPIFTGTDSYSQIQLLIEYLGTPDEQVIRRIKSPSIRDY-ISSFGPK----- 299

  Fly   269 LSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYASAEMDLHM 333
                    .......|..|...:..::|..:|.::|..|.:|::.:..|:|..:.....|     
 Worm   300 --------TPLPFTAMFPNASIEARNIVSKMLQISPWKRFSAEQLLEEPFVKHWHTVKNE----- 351

  Fly   334 DVVPPLKDHVRYDV 347
               |...:|:|.::
 Worm   352 ---PSCPNHIRQNL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 101/339 (30%)
F09C12.2NP_872069.1 STKc_MAPK 44..355 CDD:270828 99/330 (30%)
S_TKc 44..342 CDD:214567 96/309 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.