DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and p38b

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster


Alignment Length:321 Identity:116/321 - (36%)
Similarity:185/321 - (57%) Gaps:39/321 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELDQTVESIFDVRKRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFR 80
            |:.:|.:::    :.:|:||||.|.||..|.|...||:||:...|:....|:|||||:..|:...
  Fly    19 EIPETYQNL----QPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMD 79

  Fly    81 CHPNIVRLVDIF---KASNNLD----FYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIK 138
             |.|::.|:|:|   :.:::||    .|:|...|::||:|:| |...|.|.|.:|::||::..:|
  Fly    80 -HENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNII-RTQKLSDDHVQFLVYQILRGLK 142

  Fly   139 FIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPEI 203
            :|||..|||||||||||.::..|.|::.||||||...|.           :|.||||||||||||
  Fly   143 YIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESE-----------MTGYVATRWYRAPEI 196

  Fly   204 LVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASIGPSFGSVL 268
            ::...:|.:..|:|.:|||:.|::..:.||.||..::|:..|:..|.  |..|      .|.|.:
  Fly   197 MLNWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLG--TPAD------EFMSRI 253

  Fly   269 LS---RNIQRD----RRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRF 322
            .|   ||..|.    .|.:..::.:......|.|::.:|.|:...|:||::|:.|||:.::
  Fly   254 SSESARNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKY 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 115/320 (36%)
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 116/321 (36%)
S_TKc 24..311 CDD:214567 113/311 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442182
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.