DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and Mapk12

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:XP_006521121.1 Gene:Mapk12 / 29857 MGIID:1353438 Length:390 Species:Mus musculus


Alignment Length:333 Identity:122/333 - (36%)
Similarity:189/333 - (56%) Gaps:42/333 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QELDQT---VESIFDVRKRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFL 76
            ||:.:|   |.:::...:.:|.||||.|..|.|.||.|.||:||::..|:.|..|:|.|||:..|
Mouse    14 QEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYRPFQSELFAKRAYRELRLL 78

  Fly    77 RAFRCHPNIVRLVDIFKASNNL----DFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAI 137
            :..| |.|::.|:|:|....:|    |||||..||.:||..::|...:.:| ..:|::||::..:
Mouse    79 KHMR-HENVIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLMKHETLSED-RIQFLVYQMLKGL 141

  Fly   138 KFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPE 202
            |:||:..||||||||.|:.::..|.||:.||||||           :.|..:|.||.||||||||
Mouse   142 KYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLAR-----------QADSEMTGYVVTRWYRAPE 195

  Fly   203 ILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKI--VTSLPN---VTKLDIASI-- 260
            :::....||:.:|:|.:|||:.|||..|.||:|...::|:::|  :|..|.   |.||..|.:  
Mouse   196 VILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMKITGTPPPEFVQKLQSAEVSG 260

  Fly   261 -----GPSFGS--VLLSRNIQRDRRYSLDEMMK--------NCCDDGISLVKALLVLNPHNRLTA 310
                 |...|.  :.|..:..::....|.|:.|        |.....::|::.:|||:...|:||
Mouse   261 SGWWAGLGLGGWPITLFPSQAKNYMEGLPELEKKDFASVLTNASPQAVNLLERMLVLDAEQRVTA 325

  Fly   311 KEAIRHPY 318
            .||:.|||
Mouse   326 AEALTHPY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 120/331 (36%)
Mapk12XP_006521121.1 STKc_p38gamma 11..376 CDD:143385 122/333 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.