DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Erk7 and Mapk8

DIOPT Version :9

Sequence 1:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_446281.2 Gene:Mapk8 / 116554 RGDID:621506 Length:427 Species:Rattus norvegicus


Alignment Length:460 Identity:133/460 - (28%)
Similarity:222/460 - (48%) Gaps:97/460 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ESIFDVRKR------MGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFR 80
            :|.|.|.||      :|.||.|||..|.|...:..||:||:...|:::|.|:|.|||::.::...
  Rat    17 DSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVN 81

  Fly    81 CHPNIVRLVDIFKASNNL----DFYLVFEFMESDLHNVIKRGNVLKDVHKR--FVMYQLINAIKF 139
             |.||:.|:::|....:|    |.|:|.|.|:::|..||:    ::..|:|  :::||::..||.
  Rat    82 -HKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ----MELDHERMSYLLYQMLCGIKH 141

  Fly   140 IHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPEIL 204
            :||..:||||||||||::.|.|.||:.|||||||..:         ..|:|.||.||:|||||::
  Rat   142 LHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGT---------SFMMTPYVVTRYYRAPEVI 197

  Fly   205 VASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASIGPSFGSVLL 269
            : ...|.:.:|:|.:|||:|||:..|.||.|...::|..|::..|.......:..:.|:..:.: 
  Rat   198 L-GMGYKENVDLWSVGCIMGEMVCLKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYV- 260

  Fly   270 SRNIQRDRRYSLDEMM------------KNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRF 322
             .|..:...||.:::.            |........|:..:||::...|::..||::|||::.:
  Rat   261 -ENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVW 324

  Fly   323 QYASAEMDLHMDVVPPLK------DHVRYDVDQYRNSLY-ELIDRETSCSNRTVSNSTPSSNRDE 380
             |..:|.:     .||.|      |...:.:::::..:| |::|.|....|..:..         
  Rat   325 -YDPSEAE-----APPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRG--------- 374

  Fly   381 LPKPVRVTKQARTTSAKQPTTSPAERKKEPSSVEVTQSRKNIKLLGSAHKAQSKEINHMESAITQ 445
                             ||:         |....|        :.||.|...|..:|.|.|..|.
  Rat   375 -----------------QPS---------PLGAAV--------INGSQHPVSSPSVNDMSSMSTD 405

  Fly   446 VSIAS 450
            .::||
  Rat   406 PTLAS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 116/366 (32%)
Mapk8NP_446281.2 STKc_JNK 25..360 CDD:270840 111/357 (31%)
S_TKc 26..321 CDD:214567 102/311 (33%)
TXY 183..185 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..411 15/86 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.