DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and PDX3

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_009591.1 Gene:PDX3 / 852323 SGDID:S000000239 Length:228 Species:Saccharomyces cerevisiae


Alignment Length:181 Identity:49/181 - (27%)
Similarity:83/181 - (45%) Gaps:18/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EQRVYEEPHVIFQNWLMAAQKEAPQVRPRLACMATVD-KSGEPVTRLTSIEEVNSHGITFFTTLG 103
            |:::.::|..:|..|...|:::..:..|.....::.: .||...:|:...:|::..|.|.::..|
Yeast    28 EKQLTDDPIDLFTKWFNEAKEDPRETLPEAITFSSAELPSGRVSSRILLFKELDHRGFTIYSNWG 92

  Fly   104 -SRQAGEISANPHVSLHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFPRHVQMSITHGPRYAAA 167
             ||:|.:|:.||:.::.|.|..|.|.||:.|....:..|.....|:..||        |.:..| 
Yeast    93 TSRKAHDIATNPNAAIVFFWKDLQRQVRVEGITEHVNRETSERYFKTRPR--------GSKIGA- 148

  Fly   168 EWQSRSGFFARIGQRL------NTWLGKQPEEIPMPHNWGGYILTPSLYEF 212
             |.||.....:..:.|      ||...|..|:||.|..|||..:.|...||
Yeast   149 -WASRQSDVIKNREELDELTQKNTERFKDAEDIPCPDYWGGLRIVPLEIEF 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 49/181 (27%)
Pyridox_oxidase 66..142 CDD:279568 21/77 (27%)
PDX3NP_009591.1 PdxH 13..228 CDD:223337 49/181 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345181
Domainoid 1 1.000 66 1.000 Domainoid score I2371
eggNOG 1 0.900 - - E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1192
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.750

Return to query results.
Submit another query.