DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and PPOX

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_568717.2 Gene:PPOX / 835061 AraportID:AT5G49970 Length:530 Species:Arabidopsis thaliana


Alignment Length:197 Identity:54/197 - (27%)
Similarity:92/197 - (46%) Gaps:29/197 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AAHQVSCIGSE--EQRVYEEPHVIFQNWLMAAQKEAPQVRPRLACMATVDKSGEPVTRLTSIEEV 91
            :|.:|:.:..|  |::|..:|.|.|:.|...|.....:....:| ::|.:|..:|.:|:..::..
plant   318 SAMRVNYVSPELLEEQVETDPTVQFRKWFDEAVAAGLRETNAMA-LSTANKDKKPSSRMVLLKGF 381

  Fly    92 NSHGITFFTTLGSRQAGEISANPHVSLHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFPRHVQM 156
            :.:|..:||...|::..::|.||..:|.|.|..|.|.|||.|...::.|.:..:.|...||..|:
plant   382 DENGFVWFTNYESKKGSDLSENPSAALLFYWEILNRQVRIEGPVERIPESESENYFHSRPRGSQI 446

  Fly   157 --------SITHGPRYAAAEWQSRSGFFARIGQRLNTWLGKQPEE---IPMPHNWGGYILTPSLY 210
                    |:..|......|::.               |.||..:   ||.|.||||:.|.|:|:
plant   447 GAIVSKQSSVVPGRHVLYDEYEE---------------LTKQYSDGSVIPKPKNWGGFRLKPNLF 496

  Fly   211 EF 212
            ||
plant   497 EF 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 51/184 (28%)
Pyridox_oxidase 66..142 CDD:279568 22/75 (29%)
PPOXNP_568717.2 PLN02918 4..530 CDD:215496 54/197 (27%)
YjeF_N 65..309 CDD:294225
Pyridox_oxidase 347..432 CDD:279568 23/85 (27%)
PNPOx_C 486..530 CDD:287549 8/13 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.