DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and AT2G46580

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_566081.1 Gene:AT2G46580 / 819270 AraportID:AT2G46580 Length:198 Species:Arabidopsis thaliana


Alignment Length:64 Identity:18/64 - (28%)
Similarity:27/64 - (42%) Gaps:2/64 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MATVDKSGEPVTRLTSIE--EVNSHGITFFTTLGSRQAGEISANPHVSLHFNWAPLMRSVRIAG 133
            :||:..:|.|..|.....  |.||..|...|.|.||:..|:...|...:.:.::......||.|
plant    30 LATIGLNGRPSNRTVVFRGFEENSDRIQINTDLRSRKIEELKHCPFSEMCWYFSDTWEQFRING 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 18/64 (28%)
Pyridox_oxidase 66..142 CDD:279568 18/64 (28%)
AT2G46580NP_566081.1 COG5135 6..198 CDD:330507 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2676
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.