Sequence 1: | NP_731188.1 | Gene: | CG31473 / 318753 | FlyBaseID: | FBgn0051473 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_566081.1 | Gene: | AT2G46580 / 819270 | AraportID: | AT2G46580 | Length: | 198 | Species: | Arabidopsis thaliana |
Alignment Length: | 64 | Identity: | 18/64 - (28%) |
---|---|---|---|
Similarity: | 27/64 - (42%) | Gaps: | 2/64 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 MATVDKSGEPVTRLTSIE--EVNSHGITFFTTLGSRQAGEISANPHVSLHFNWAPLMRSVRIAG 133 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31473 | NP_731188.1 | PRK05679 | 40..229 | CDD:235555 | 18/64 (28%) |
Pyridox_oxidase | 66..142 | CDD:279568 | 18/64 (28%) | ||
AT2G46580 | NP_566081.1 | COG5135 | 6..198 | CDD:330507 | 18/64 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 45 | 1.000 | Inparanoid score | I2676 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10851 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.150 |