DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and PNPO

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_060599.1 Gene:PNPO / 55163 HGNCID:30260 Length:261 Species:Homo sapiens


Alignment Length:279 Identity:78/279 - (27%)
Similarity:114/279 - (40%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLWSAG---SLGRFAQHMSNAAH-------------QVSCIGSEEQRVYEEPHVI-------FQN 53
            |.|..|   :.||.|:.....:|             :.|..|..|  .:||.|:.       |..
Human     2 TCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDRE--AFEETHLTSLDPVKQFAA 64

  Fly    54 WLMAAQKEAPQV-RPRLACMATVDKSGEPVTRLTSIEEVNSHGITFFTTLGSRQAGEISANPHVS 117
            |...| .:.|.: .....|:||..:.|:|..|:..::.....|..|||...||:..|:.:||..|
Human    65 WFEEA-VQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFAS 128

  Fly   118 LHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFPRHVQMSITHGPRYAAAEWQSR----SGFFAR 178
            |.|.|.||.|.||:.|...:|.||:....|...|:..|:.       |....||.    ..:..:
Human   129 LVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIG-------AVVSHQSSVIPDREYLRK 186

  Fly   179 IGQRLNTWLGKQPEEIPMPHNWGGYILTPSLYEFGMLSGEKAGRT-----RVRFRRCL---EMPR 235
            ..:.|....  |.:|:|.|.:||||:|.|.:.||..      |:|     |:.|||.|   :.|.
Human   187 KNEELEQLY--QDQEVPKPKSWGGYVLYPQVMEFWQ------GQTNRLHDRIVFRRGLPTGDSPL 243

  Fly   236 G--TRVGHVQAERQDWVYD 252
            |  |..|     .:||:|:
Human   244 GPMTHRG-----EEDWLYE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 59/205 (29%)
Pyridox_oxidase 66..142 CDD:279568 27/75 (36%)
PNPONP_060599.1 Pyridoxal 5'-phosphate binding. /evidence=ECO:0000250|UniProtKB:P0AFI7 42..45 1/2 (50%)
pdxH 57..261 CDD:273138 65/222 (29%)
Pyridoxal 5'-phosphate binding. /evidence=ECO:0000250|UniProtKB:P0AFI7 225..227 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154986
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1192
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.