DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and sgll

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_731186.2 Gene:sgll / 40925 FlyBaseID:FBgn0051472 Length:246 Species:Drosophila melanogaster


Alignment Length:229 Identity:77/229 - (33%)
Similarity:113/229 - (49%) Gaps:36/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EEQRVYEEPHVIFQNWLMAAQKEAPQVRPRLACMATVDKSGEPVTRLTSIEEVNSHGITFFTTLG 103
            |:....:.|..:|::||..|.|....:.|..|.:|||...|.|..|...::|..:.|.||||..|
  Fly    35 EDNIKVKNPFCVFRDWLELALKTPEILEPNAAALATVSAEGRPSNRYVLVKEATAEGFTFFTNYG 99

  Fly   104 SRQAGEISANPHVSLHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFPRHVQMSITHGPRYAAAE 168
            ||:|.:|.:||:|::.|.|.||.|||||.|.|.:::.|.....|.:.||..|:.....|:  :..
  Fly   100 SRKAEDIKSNPYVAISFYWLPLRRSVRIEGVAEKISVEDSLKYFHQRPRASQIGAAASPQ--SQR 162

  Fly   169 WQSRSGFFARIGQRLNTWLGKQPE-EIPMPHNWGGYILTPSLYEFGMLSGEKAGRT-----RVRF 227
            ..||| :...:...:...||  |: |:|:| |||||::.|.|.||..      |:|     |:||
  Fly   163 IPSRS-YLDDVEAAIKLELG--PDGEVPLP-NWGGYLVRPDLIEFWQ------GQTDRLHDRIRF 217

  Fly   228 RRCLEMPRGTRVGHVQAE---------RQDWVYD 252
            |         |.|.|::|         ...|||:
  Fly   218 R---------RGGGVESEVDSKLVHKGEDGWVYE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 68/194 (35%)
Pyridox_oxidase 66..142 CDD:279568 33/75 (44%)
sgllNP_731186.2 pdxH 42..246 CDD:273138 76/222 (34%)
Pyridox_oxidase 59..135 CDD:279568 33/75 (44%)
PNPOx_C 191..246 CDD:287549 21/67 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460596
Domainoid 1 1.000 66 1.000 Domainoid score I2371
eggNOG 1 0.900 - - E1_COG0259
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2676
Isobase 1 0.950 - 0 Normalized mean entropy S1192
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.