DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and pnpo

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001243107.1 Gene:pnpo / 402868 ZFINID:ZDB-GENE-060602-2 Length:277 Species:Danio rerio


Alignment Length:287 Identity:77/287 - (26%)
Similarity:118/287 - (41%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WCTLWSAGSLGRFAQ-HMSNAAHQVSCIGS-----------------------EEQRVYEE---- 46
            :||..:..::.:|.| .:::..|..|...|                       .:|..:||    
Zfish     7 FCTSRNISNILKFIQPSVASRVHSPSLFTSFFCRTFSDSGTSMDLSNMRKTYKSDQECFEENQLA 71

  Fly    47 ---PHVIFQNWLMAAQKEAPQV-RPRLACMATVDKSGEPVTRLTSIEEVNSHGITFFTTLGSRQA 107
               |...|.:|...|.| .|:| .....|:||..|.|.|..|:..::..:..|..||:...||:.
Zfish    72 SLDPIKQFGSWFDQATK-CPEVGEANAMCLATATKDGHPSARMVLLKGYSEEGFCFFSNYESRKG 135

  Fly   108 GEISANPHVSLHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFPRHVQMSITHGPRYAAAEWQSR 172
            .|:.:|||..|.|.|.||.|.:||.|:..::..|:.|:.|...|:..|:...          .||
Zfish   136 SELESNPHACLVFYWEPLNRQIRIEGTVERIPYEKSREYFHSRPKSSQIGAV----------VSR 190

  Fly   173 SGFFARIGQRLNTWLGKQPE-----EIPMPHNWGGYILTPSLYEFGMLSGEKAGRT-----RVRF 227
            ........|.|.....:..|     ::|||..|||||:.|||.||..      |:|     |:.|
Zfish   191 QSTVIPSRQYLRDKNAELEEKFKDTDVPMPDYWGGYIVKPSLIEFWQ------GQTNRLHDRIVF 249

  Fly   228 RRCLEMPRG--TRVGHVQAERQ-DWVY 251
            .|    |:|  |.:|.:|.:.: .|:|
Zfish   250 LR----PKGGETELGDMQHQAEGGWIY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 62/206 (30%)
Pyridox_oxidase 66..142 CDD:279568 25/75 (33%)
pnpoNP_001243107.1 pdxH 74..277 CDD:273138 67/220 (30%)
Pyridox_oxidase 94..167 CDD:279568 25/72 (35%)
PNPOx_C 223..277 CDD:287549 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590016
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.