DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and CG15343

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_572469.1 Gene:CG15343 / 31765 FlyBaseID:FBgn0030029 Length:213 Species:Drosophila melanogaster


Alignment Length:178 Identity:36/178 - (20%)
Similarity:58/178 - (32%) Gaps:46/178 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EPHVIFQNWLMAAQKEAPQVRPRLACMATVDKSGEPVTRLTSIEEVNSHGITFFTT-LGSRQAGE 109
            :|...|:..|..|.|..|....:...:||||:....:.|......:......|:.| ...|....
  Fly    14 DPVEFFKEILQEAAKGHPDGFIQEMNLATVDEEFGVLNRTVLYRGLTQDNCVFYITHRYVRNFKN 78

  Fly   110 ISANPHVSLHFNWAPLMR---------SVRIAGS--------------AHQLTEEQVR------- 144
            :.|||...:.| :.|.::         .||:.|:              |.:....|:|       
  Fly    79 LQANPKACITF-YMPDVKDKAGNQNAWQVRLIGATAVELDQSEMDALWAKENLAAQIRGHICPCG 142

  Fly   145 ------------DQFRRFPRHVQMSITHGPRYAAAEWQSRSGFFARIG 180
                        |||  ...|...||.....|.|.::|.:...|.::|
  Fly   143 EPINYDDLKAKHDQF--LLDHRGKSIERPASYTAWKFQPQRWDFLKVG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 36/178 (20%)
Pyridox_oxidase 66..142 CDD:279568 17/99 (17%)
CG15343NP_572469.1 pdxH 14..207 CDD:273138 36/178 (20%)
Pyridox_oxidase 34..120 CDD:279568 16/86 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460598
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0259
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.