DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and SPAC1093.02

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_594650.1 Gene:SPAC1093.02 / 2542998 PomBaseID:SPAC1093.02 Length:231 Species:Schizosaccharomyces pombe


Alignment Length:216 Identity:59/216 - (27%)
Similarity:101/216 - (46%) Gaps:28/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QHMSNAAHQVSCIGSEEQRVYEEPHVIFQNWLMAAQKEAPQVRPRLACMATVD-KSGEPVTRLTS 87
            |:..::.|:.:.:|       ::|.|:|..|...|..:.....|....::|.. .||...:||..
pombe    20 QYEKSSLHRDALMG-------KDPLVLFNQWFQEATDDEGIKSPESTTLSTARLPSGRVSSRLVL 77

  Fly    88 IEEVNSHGITFFTTLG-SRQAGEISANPHVSLHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFP 151
            ::|::..|...||.|| |::|.::.:||:.||.|.|.||.|.||:.|...:|:.|:..:.|:..|
pombe    78 LKELDHRGFIIFTNLGTSKKAKDLKSNPYASLSFWWEPLQRQVRVEGIIERLSREETEEYFKTRP 142

  Fly   152 RHVQMSITHGPRYAAAEWQS-RSGFFA---RIGQRLNTWLGKQPEE----IPMPHNWGGYILTPS 208
            |:.::          ..|.| :|...|   .:.:|:..:..|..|:    :|:|..|||..:.|.
pombe   143 RNSRI----------GAWASPQSEVIADREELEKRVEEYKKKFGEDESVPVPVPDFWGGIRIVPL 197

  Fly   209 LYEFGMLSGEKAGRTRVRFRR 229
            ..||.. .|:.....|..|||
pombe   198 EIEFWQ-GGKYRLHDRFSFRR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 54/198 (27%)
Pyridox_oxidase 66..142 CDD:279568 27/77 (35%)
SPAC1093.02NP_594650.1 PdxH 13..231 CDD:223337 59/216 (27%)
Pyridox_oxidase 51..133 CDD:279568 27/81 (33%)
PNPOx_C 189..231 CDD:287549 11/30 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.