DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and F57B9.1

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001370689.1 Gene:F57B9.1 / 175973 WormBaseID:WBGene00018996 Length:226 Species:Caenorhabditis elegans


Alignment Length:210 Identity:46/210 - (21%)
Similarity:81/210 - (38%) Gaps:47/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PHVIFQNWL--MAAQKEAPQVRPRLACMATVDKSGEPVTRLTSIEEVNSHGITFFTTLGSRQAGE 109
            |..:|..|.  :|:|.:..........::||.|...|.:|:..::.....|.:|:|...||:..:
 Worm    33 PFELFDIWFRNVASQSDLTFEEINAVSLSTVGKDLRPSSRMVLLKAYTPTGFSFYTNYTSRKGNQ 97

  Fly   110 ISANPHVSLHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFPRHVQMSITHGPRYAAAEWQSRSG 174
            :..||:.::.|.|..:.|.:|:.|...:|.:|.                      |.|.|.||. 
 Worm    98 LEENPNAAMLFYWPKVNRQIRVEGVVEKLPDEM----------------------AVAYWNSRP- 139

  Fly   175 FFARIGQRLNTWLGKQPEE---------------------IPMPHNWGGYILTPSLYEFGMLSGE 218
            ..:|||.:.:......|:.                     |..|.:||||.|.|..:||.....:
 Worm   140 VASRIGSKSSDQSKVVPDREFLESKKVALTELSVREGAQAITKPESWGGYHLIPRYFEFWQGQSD 204

  Fly   219 KAGRTRVRFRRCLEM 233
            :. ..|:.|.|.:::
 Worm   205 RL-HDRIVFERDVDV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 45/204 (22%)
Pyridox_oxidase 66..142 CDD:279568 18/75 (24%)
F57B9.1NP_001370689.1 pdxH 32..226 CDD:273138 46/210 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1192
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.