DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31473 and pnpo

DIOPT Version :9

Sequence 1:NP_731188.1 Gene:CG31473 / 318753 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001120016.1 Gene:pnpo / 100144978 XenbaseID:XB-GENE-955839 Length:228 Species:Xenopus tropicalis


Alignment Length:243 Identity:66/243 - (27%)
Similarity:99/243 - (40%) Gaps:49/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IGSEEQR------VYEEPHVI-------FQNWLMAAQKEAPQV-RPRLACMATVDKSGEPVTRLT 86
            :||..:|      .:||.|::       |..|.... .:.|.: .|...|:||..:.|.|..|:.
 Frog     3 LGSMRKRYRSDNEAFEEKHLVSLDPIIQFNAWFQEV-TQCPAIEEPNAMCLATATRDGRPSARMV 66

  Fly    87 SIEEVNSHGITFFTTLGSRQAGEISANPHVSLHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFP 151
            .::.....|..|:|...||:..|:..||..||.|.|.|..|.|||.||..:|:||:....|...|
 Frog    67 LLKGFGPDGFRFYTNRESRKGLELETNPVASLLFYWEPFNRQVRIEGSIERLSEEESEKYFHSRP 131

  Fly   152 RHVQMSITHGPRYAAAEWQSRSGFFARIGQRLNTWLGKQ--PEEIPMPHNWGGYILTPSLYEFGM 214
            :..|:.       ||...||:........::.|..|..:  ..|:|.|..||||::.|::.||..
 Frog   132 KSSQIG-------AAVSKQSQVIPDREYLRQKNAELEAEYKDREVPKPPEWGGYVVHPTVIEFWQ 189

  Fly   215 LSGEKAGRTRVRFRRCLEMPRGTRVGHVQAERQD-----------WVY 251
                  |:|.....|.        |.|.|.:.::           |||
 Frog   190 ------GQTNRLHDRI--------VFHKQEKDEELALWTHRGEGGWVY 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 57/204 (28%)
Pyridox_oxidase 66..142 CDD:279568 28/75 (37%)
pnpoNP_001120016.1 pdxH 26..228 CDD:273138 60/220 (27%)
Pyridox_oxidase 44..122 CDD:279568 28/77 (36%)
PNPOx_C 175..228 CDD:287549 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.