DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31467 and Ppp1r36

DIOPT Version :9

Sequence 1:NP_731492.1 Gene:CG31467 / 318751 FlyBaseID:FBgn0051467 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001156575.1 Gene:Ppp1r36 / 210762 MGIID:2684916 Length:411 Species:Mus musculus


Alignment Length:402 Identity:90/402 - (22%)
Similarity:153/402 - (38%) Gaps:87/402 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PKYYS--------------------GKWSWDSEKDCLHFQAHNDLENARERYIMTNGYRFLRTID 55
            |::||                    |.|.|..|...|.|::.......:|:........|.....
Mouse    11 PEFYSRRKQFVGQSSTRLDQCGLRLGMWYWKDETKTLEFKSFTPAIELKEKGKKGKAVHFAEMDS 75

  Fly    56 QEEELIFRQEY---------VLPKSNYSDVVVVGDIRNL-VLYLMPSEFLTY-KFVEFMYERDTH 109
            ...|.:..:.:         .|.|.:....|.:.|::.: :|.|..:|.... .|..|:..::..
Mouse    76 GASERLTDKRFASRDEKAAKALEKRSQQGNVTLDDVKFVALLSLQDTEMQRICSFTTFLRNKNLD 140

  Fly   110 LLLHSLIIYFEHYLRLVEFILIRRDELSGPLGQVQSEQTNDMKRTFSVYLSQYRMLVARNYCRII 174
            ..|.:|:.|..:||:.:.   :.::..|..:|.::.::...:...    |...:..:|:.||.::
Mouse   141 SFLMALLYYLSYYLQRLS---MEKNPQSRVVGLIEKKEVELVVNK----LEDAQKYLAQKYCILV 198

  Fly   175 GGEDNMSKYYHMKPISNISATIHDKFFHEHFLAVAIQIVWICMHRRAYYVIEMEINRLFRSEHF- 238
            .|.....|::.......||.|..|..|.|.|......|.||...|:....||.|:.||||:..| 
Mouse   199 LGLGMADKHHLSCGKEKISDTQKDWKFFESFYTFCTCIAWIVFRRQYLTEIEEEVGRLFRTNMFN 263

  Fly   239 --VSAHPEYLEFTEAER-SLLYGRN--------KKNYNYRIQESPLVQELKLVPEEDLPIL---- 288
              ...|.:.....|.:| :|:..|.        ||..:.|   ||::..|       ||.|    
Mouse   264 IPRRKHEDEASGGEKKRMTLVQFRRMMAKRPAIKKAVDMR---SPVLSTL-------LPSLREKA 318

  Fly   289 -WIGERKYRGNDIRIAEIELEYIVPGSQLSFIDVSH------GIMGHPKSLY--NTLLSLDW--- 341
             .|.|:||      :|.|:|:   |..:....|:..      ||:|.|::|:  ||||.|:.   
Mouse   319 QHITEKKY------VAGIKLQ---PREENIITDLESVAMPIVGILGEPRNLFNPNTLLPLELEEN 374

  Fly   342 --PAVRFSNFSE 351
              |:.|.|:..|
Mouse   375 TKPSGRSSSIVE 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31467NP_731492.1 PPPI_inhib 35..375 CDD:291556 81/358 (23%)
Ppp1r36NP_001156575.1 PPPI_inhib 67..400 CDD:291556 80/346 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845738
Domainoid 1 1.000 62 1.000 Domainoid score I10281
eggNOG 1 0.900 - - E1_29A0D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5343
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.