DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31467 and PPP1R36

DIOPT Version :9

Sequence 1:NP_731492.1 Gene:CG31467 / 318751 FlyBaseID:FBgn0051467 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_758953.1 Gene:PPP1R36 / 145376 HGNCID:20097 Length:422 Species:Homo sapiens


Alignment Length:423 Identity:94/423 - (22%)
Similarity:155/423 - (36%) Gaps:100/423 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GKWSWDSEKDCLHFQA-------------HNDLENARE-----------RYIMTNGYRFLRTIDQ 56
            |.|.|..|...|.|:.             |.....|.|           .:..|:|....|..|:
Human    30 GMWYWKDETRTLEFRRFAAEDSVQWLLKHHPHFTPAAEVKEKGKKGKAVHFAETDGPASDRLTDK 94

  Fly    57 ----EEELIFRQEYVLPKSNYSDVVVVGDIRNLVLYLMPSEFL--TYKFVEFMYERDTHLLLHSL 115
                :::   :....:.|......:.:.|::.:.|.|:....:  ...|..||..::....|.:|
Human    95 RLAAKDD---KSAKAVEKRGQQGTITLDDVKFVTLLLLQDTEMQRICSFTTFMRNKNLDNFLMAL 156

  Fly   116 IIYFEHYLRLVEFILIRRDELSGPLGQVQSEQTNDMKRTFSVYLSQY---RMLVARNYCRIIGGE 177
            :.|..|||   |...:.:...|..:|.|:       |:...:.||:.   :..:|:.||.::.|.
Human   157 LYYLSHYL---EKNSLEKKPKSYMVGLVE-------KKEMELVLSELEAAQRYLAQKYCILVLGL 211

  Fly   178 DNMSKYYHMKPISNISATIHDKFFHEHFLAVAIQIVWICMHRRAYYVIEMEINRLFRSEHF---- 238
            ....|::.......||.|..|..|.|.|......:.||...|:....||.|:.||||:..|    
Human   212 AVPDKHHMCCGKEKISDTQKDWKFFESFYTFCTYVAWIVFRRQHLTEIEEEVGRLFRTNMFNIPR 276

  Fly   239 ----------VSAHPEYLEFTE--AERSLLYGRNKKNYNYRIQESPLVQELKLVPEEDLPILW-- 289
                      ......:::|..  |:|..:    ||..|.|   ||::..|       ||.|.  
Human   277 RRREDEESGGEKKRMTFVQFRRMMAKRPAI----KKAINMR---SPVMSTL-------LPSLREK 327

  Fly   290 ---IGERKYRGNDIRI-AEIELEYIVPGSQLSFIDVSHGIMGHPKSLYN--TLLSLD-------- 340
               :.|:||...|:|. ||::...   |:..|......||:|.|:.|:|  ||..||        
Human   328 AQNVFEKKYHQVDVRFPAEMQKHV---GTLDSVPMPVVGILGEPRCLFNPHTLHPLDPEENTKSF 389

  Fly   341 --WPAVRFSNFSEKFDPYHIIRR---PHLQIPK 368
              :|::..:|.....|...::.:   .|...||
Human   390 GRYPSLMENNNMRIQDTLDLVMKTLSSHTSCPK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31467NP_731492.1 PPPI_inhib 35..375 CDD:291556 87/391 (22%)
PPP1R36NP_758953.1 PPPI_inhib 79..412 CDD:291556 82/362 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155266
Domainoid 1 1.000 60 1.000 Domainoid score I10583
eggNOG 1 0.900 - - E1_29A0D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1188799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.