DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31460 and AT1G77350

DIOPT Version :9

Sequence 1:NP_001287236.1 Gene:CG31460 / 318747 FlyBaseID:FBgn0051460 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001031293.1 Gene:AT1G77350 / 844071 AraportID:AT1G77350 Length:122 Species:Arabidopsis thaliana


Alignment Length:106 Identity:40/106 - (37%)
Similarity:56/106 - (52%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SGLLSIVLFGTLRFCSEWFN----DSQLRVLLGGYLFSWVFILSLTCVSN-AEMVVFGQDFQAKL 76
            |.|.|:::|..:....|.:.    .|:|..:|||:..|.:|:.|||.:.| .|.......:.|.:
plant     8 SMLGSLIVFTVILSLQEIYRGKLASSELFTILGGFTSSLLFLFSLTFIGNFQESSGIKSGWGAVI 72

  Fly    77 LPEIIFCLSLTVAAAGLVHRVCATTSVLFSLVGLYFLNRIS 117
            |.|||     .:.|||.|||||.||..|||...||.:|:||
plant    73 LAEII-----ALIAAGTVHRVCITTCFLFSAGLLYEVNKIS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31460NP_001287236.1 Keratin_assoc 15..132 CDD:286816 40/106 (38%)
AT1G77350NP_001031293.1 Keratin_assoc 6..121 CDD:401649 40/106 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4242
eggNOG 1 0.900 - - E1_KOG4615
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2615
OMA 1 1.010 - - QHG55784
OrthoDB 1 1.010 - - D1561955at2759
OrthoFinder 1 1.000 - - FOG0006561
OrthoInspector 1 1.000 - - oto3072
orthoMCL 1 0.900 - - OOG6_107389
Panther 1 1.100 - - LDO PTHR32001
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.