DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31460 and krtcap2

DIOPT Version :9

Sequence 1:NP_001287236.1 Gene:CG31460 / 318747 FlyBaseID:FBgn0051460 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001038827.1 Gene:krtcap2 / 751643 ZFINID:ZDB-GENE-060825-91 Length:135 Species:Danio rerio


Alignment Length:131 Identity:55/131 - (41%)
Similarity:84/131 - (64%) Gaps:0/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 STVVSSIISGLLSIVLFGTLRFCSEWFNDSQLRVLLGGYLFSWVFILSLTCVSNAEMVVFGQDFQ 73
            :|..|.::|.|||:::|..::..|.....|:...:|||:|.|.:||.|||..:|.|.:|||:.||
Zfish     4 NTSTSLVLSSLLSVLVFAGMQMFSRQLASSEWLTILGGFLGSLLFICSLTAFNNLENLVFGKGFQ 68

  Fly    74 AKLLPEIIFCLSLTVAAAGLVHRVCATTSVLFSLVGLYFLNRISTKYYSVQVPSVDAPTTRKGGK 138
            ||:.|||:.|:.|.:.|:|||||||.||.::||:..||::|::|...|......:.|..|.||.:
Zfish    69 AKIFPEIVVCMFLALFASGLVHRVCVTTCLIFSVFALYYINKVSAALYQAAPAPIPAKPTSKGKR 133

  Fly   139 K 139
            |
Zfish   134 K 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31460NP_001287236.1 Keratin_assoc 15..132 CDD:286816 49/116 (42%)
krtcap2NP_001038827.1 Keratin_assoc 20..117 CDD:286816 43/96 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583272
Domainoid 1 1.000 107 1.000 Domainoid score I6483
eggNOG 1 0.900 - - E1_KOG4615
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15494
Inparanoid 1 1.050 114 1.000 Inparanoid score I4823
OMA 1 1.010 - - QHG55784
OrthoDB 1 1.010 - - D1561955at2759
OrthoFinder 1 1.000 - - FOG0006561
OrthoInspector 1 1.000 - - oto40283
orthoMCL 1 0.900 - - OOG6_107389
Panther 1 1.100 - - LDO PTHR32001
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4624
SonicParanoid 1 1.000 - - X4801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.