DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31460 and Krtcap2

DIOPT Version :9

Sequence 1:NP_001287236.1 Gene:CG31460 / 318747 FlyBaseID:FBgn0051460 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_006501933.3 Gene:Krtcap2 / 66059 MGIID:1913309 Length:219 Species:Mus musculus


Alignment Length:131 Identity:57/131 - (43%)
Similarity:83/131 - (63%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TVVSSIISGLLSIVLFGTLRFCSEWFNDSQLRVLLGGYLFSWVFILSLTCVSNAEMVVFGQDFQA 74
            |..|..:|.|||::||..::..|.....::...:.||.|.|.:|:.|||..:|.|.:|||:.|||
Mouse    88 TGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQA 152

  Fly    75 KLLPEIIFCLSLTVAAAGLVHRVCATTSVLFSLVGLYFLNRISTKYYSVQVPSV-DAPTTRKGGK 138
            |:.|||:.||.|.:.|:||:||||.||..:||:||||::|:||:..|....|.: .|..|.||.|
Mouse   153 KIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLTPAKITGKGKK 217

  Fly   139 K 139
            :
Mouse   218 R 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31460NP_001287236.1 Keratin_assoc 15..132 CDD:286816 51/117 (44%)
Krtcap2XP_006501933.3 Keratin_assoc 86..214 CDD:370681 54/125 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839272
Domainoid 1 1.000 108 1.000 Domainoid score I6497
eggNOG 1 0.900 - - E1_KOG4615
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15494
Inparanoid 1 1.050 111 1.000 Inparanoid score I4869
Isobase 1 0.950 - 0 Normalized mean entropy S7097
OMA 1 1.010 - - QHG55784
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006561
OrthoInspector 1 1.000 - - oto93911
orthoMCL 1 0.900 - - OOG6_107389
Panther 1 1.100 - - LDO PTHR32001
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4624
SonicParanoid 1 1.000 - - X4801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.