DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31460 and Krtcap2

DIOPT Version :9

Sequence 1:NP_001287236.1 Gene:CG31460 / 318747 FlyBaseID:FBgn0051460 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001099914.1 Gene:Krtcap2 / 295243 RGDID:1308413 Length:114 Species:Rattus norvegicus


Alignment Length:109 Identity:49/109 - (44%)
Similarity:70/109 - (64%) Gaps:7/109 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SEWFNDSQLRVLLGGYLFSWVFILSLTCVSNAEMVVFGQDFQAKLLPEIIFCLSLTVAAAGLVHR 96
            :||.      .:.||.|.|.:|:.|||..:|.|.:|||:.||||:.|||:.||.|.:.|:||:||
  Rat    11 TEWL------TIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHR 69

  Fly    97 VCATTSVLFSLVGLYFLNRISTKYYSVQVPSV-DAPTTRKGGKK 139
            ||.||..:||:||||::|:||:..|....|:: .|..|.|..|:
  Rat    70 VCVTTCFIFSMVGLYYINKISSTLYQATAPALTPAKVTGKSKKR 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31460NP_001287236.1 Keratin_assoc 15..132 CDD:286816 46/100 (46%)
Krtcap2NP_001099914.1 Keratin_assoc 1..109 CDD:401649 47/103 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343077
Domainoid 1 1.000 109 1.000 Domainoid score I6250
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15494
Inparanoid 1 1.050 110 1.000 Inparanoid score I4796
OMA 1 1.010 - - QHG55784
OrthoDB 1 1.010 - - D1561955at2759
OrthoFinder 1 1.000 - - FOG0006561
OrthoInspector 1 1.000 - - oto97446
orthoMCL 1 0.900 - - OOG6_107389
Panther 1 1.100 - - LDO PTHR32001
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.