DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31454 and CG31157

DIOPT Version :9

Sequence 1:NP_731250.1 Gene:CG31454 / 318744 FlyBaseID:FBgn0051454 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001097769.2 Gene:CG31157 / 318608 FlyBaseID:FBgn0051157 Length:387 Species:Drosophila melanogaster


Alignment Length:453 Identity:94/453 - (20%)
Similarity:169/453 - (37%) Gaps:131/453 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAQSKLAEAAYKCSCQEFVHPWTSSCACATAGMLLSLIPG-----------------TFKTYSM 48
            |.|.|||.|            |..:...||    :|..:||                 :.|.||.
  Fly     1 MVAPSKLLE------------PPLNRVHCA----ILHSLPGQSCTKAFLWNLYRNHVSSAKYYSP 49

  Fly    49 VYMLALLMRRRIPSLKDLGRTLASTLQSTAFLS-LNGSLFVLAICLVRQFLGGFYFATAAWLPAL 112
            :.:|.|:|..|..|...:.....:..||.:|.: :|...|.| :|:.|:....|.|....:||..
  Fly    50 LLLLPLIMNWRKLSKSMVLSVAKNYAQSASFAAWINAITFYL-MCMGRRLNDRFVFIFIPFLPCW 113

  Fly   113 LVSSISLAVERPQRRAPLALYVANV---GIETLWKMLEARGLVRSIAKGQVLIMGASITALMYLY 174
            :.|.:|..:. ||   .|..:|..:   .:|:|.:.... |||.|.....:|.|.:|:..|.|  
  Fly   114 IASQLSWLMP-PQ---VLHFFVTGITPAAMESLMRYFNI-GLVHSPMAQTLLFMISSVIVLHY-- 171

  Fly   175 RAGLHRTVAKDATFKGLGLIIGREEEGPLKPSTVIIPQRSNLGSL------NFRCITSYLKVYNH 233
                    .:...:.|...|         :|::  :|:.:...::      ..|.:.|||     
  Fly   172 --------QQTRKYSGFWFI---------RPAS--LPEDTEDWTILKQVQQGIRELRSYL----- 212

  Fly   234 LTTLRHPCCPHQFGCAVYALLGGVKPFLGGVGVQVGFKLLLNITRILQQKME-WRKQIFNKGSLQ 297
                                         |:|:.:.   |||  .::::.|: ||.::.:..:..
  Fly   213 -----------------------------GIGLAMD---LLN--PLMKRNMKLWRPKMTSFLAGY 243

  Fly   298 LGLALGIFSLLFKMSSCGLRHSFGYDNALFAIQSGLIGSFGLLHFPNTTVSLYLMLKSLQLLYN- 361
            :||...:..||.|      |.:....|||.:..||  .||.||. ...|...:.::.::|:::: 
  Fly   244 IGLFKVVQLLLLK------RLNVNQANALASFISG--SSFALLS-NRLTFMCFAIVTAIQVIWSQ 299

  Fly   362 -WGVAEEK------VPEVPHFSMIMYGFFTAVLCHSTVLEAKSMRPSYFKFIE---NISGGRL 414
             ....:||      |.::| ::.::.....|.|.|......:.:......||:   :.:|.||
  Fly   300 VCNTKDEKDSVLSAVRKIP-WARLLIPCSLAYLVHIFFYHQRHLNEMARSFIDCTCDNNGQRL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31454NP_731250.1 TMEM135_C_rich 15..145 CDD:292604 34/150 (23%)
CG31157NP_001097769.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378483at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12459
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.