DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG10562

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster


Alignment Length:412 Identity:98/412 - (23%)
Similarity:179/412 - (43%) Gaps:65/412 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTNRKGEFQKSLIIKT 82
            |:|:.:|....:|:.| ::...|:.:......||.|::||:||.|.:::...:.|:.:....:..
  Fly     7 PDWVTAEIFEDLLKAN-VDGYSKIKNFKADIGSAAGENYATIMLRVKIEVELQDGKSKSVSYMVK 70

  Fly    83 MPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCIYHSLEPHQVLIF--- 144
            :|......::|:..:.|||.|..:|.:|:||.|.:.:.||.|                 :.|   
  Fly    71 LPHQVEAIQEMMKRTNIFEIERTMYNEVVPELEALYKAVGVD-----------------ITFGAK 118

  Fly   145 -EDL--AEMGYIVLRD----------RDATLDE--IRRIYFKLAKWHAVS-LKVQNEQPEFLESY 193
             .||  |:..|:.|.|          |...||:  ..|:..||::|||.| ::|..:.| :.:..
  Fly   119 NYDLKNAKTDYVALEDLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAVRVATKGP-YPKIL 182

  Fly   194 THGLF--EMPHVLNDPFMRTGMEFFVELL---GKEPELNKYKPYFESIKDDFLERLVEEWKDIRK 253
            ..|.|  |...|:::.....|..|.....   |.|..|:|.|    :::...::::.|..|    
  Fly   183 LQGFFKEESRPVMSEMIKGMGANFVKSCATYEGHEAYLDKVK----ALQPVAIDKIFEFAK---- 239

  Fly   254 SQKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWN 318
             .:..|:.||.|||....||||::.....:::..|:|:|:.....:..||||.:....:.|.:..
  Fly   240 -VEPTEFNVLNHGDSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLEDKLA 303

  Fly   319 NWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLMWALRDKS---- 379
            .:|..|..|...|.:.||.:.|...:||...:...|.::.|:.:.:.:..:..:  |.|.:    
  Fly   304 KFDYYIKIYHDNLVEHLKILKYSKPIPSLRDIHLALFKYGYFGYTVATGVMSAV--LLDPTDSAS 366

  Fly   380 -------VDFGDLLQNEEKRRK 394
                   .||...|.|..:.||
  Fly   367 LENFIGGSDFQMQLYNSPRYRK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 77/311 (25%)
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 77/310 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.