DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG10550

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:443 Identity:110/443 - (24%)
Similarity:195/443 - (44%) Gaps:60/443 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NPQNNQFNDDELVPPEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYT 68
            ||      ::.|..|:|:|.|:...::| .::|...|:|:|....|:|.|::|.|||.|..|...
  Fly    12 NP------NEHLHIPKWINEEYFQPIIE-KDVENFDKIINLVPIAATAPGENYTSIMIRVIVDIL 69

  Fly    69 NRKGEFQK-SLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCI 132
            .:.|..|: |.|:|||.||:. ..|::.|..:|..|..:|...:|:|.::.::.|.:.:|...|:
  Fly    70 LKDGSEQRVSYILKTMLEADS-GADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCL 133

  Fly   133 YHSLEPHQV-LIFEDLAEMGYIVL-RDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTH 195
            :.......: ::||||:...:... |.:...|..:|.:..|||:.||.|:..:.....:...|..
  Fly   134 HVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNM 198

  Fly   196 GLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLER----LVEEWKDIRKSQK 256
            .::.          ....:.| |.|||:.|    :.:.:::::..||.    :...|..:...::
  Fly   199 SIYN----------EQSRDLF-ESLGKQRE----EQFLKAMRNWDLENAESYIARMWDPLEVFEE 248

  Fly   257 --------KDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEP 313
                    :||:.||.|||....||||.:||...::..:|:|.|:........||.|.|......
  Fly   249 AVQVNQVDEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASL 313

  Fly   314 EHRWNNWDDLINYYISVLQDVLKKIGYKGVMPS---------QSGLWKRLHQHKYYEFFLISTFL 369
            :.:...:|..|..|...|.:.||.:.|...:|:         :.|.|..|....    .:::|.:
  Fly   314 DIKIKEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMG----VMVATLM 374

  Fly   370 PLMWALRDKSVDFGDLL-QNEEK---RRKCSFSKGYIKEVTILLARLDQLGLL 418
            |     .||..:...:| |..|.   |.:...:..|.|.:.:||...|..|||
  Fly   375 P-----TDKDANMKMILAQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 75/302 (25%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 75/302 (25%)
APH 108..338 CDD:279908 55/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459751
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.