DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG31097

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:402 Identity:106/402 - (26%)
Similarity:180/402 - (44%) Gaps:58/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NPQNNQFNDDELVPPEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYT 68
            ||      ::.||.|:|||......::..:|.: ..|:...|...|...|.::||:|.|..:...
  Fly     5 NP------NESLVVPKWLNKSKFESLIAKDEPD-FTKIDQFTTVAAVPPGGNFASVMLRVYLDIV 62

  Fly    69 NRKG-EFQKSLIIKTMPEAEGHKKDMLGGSPI-----FETEMGLYTKVLPEFERILRQVGDDTQL 127
            .:.| :.:||.::|||.|::      .||..:     |..|..:|:..||:||:|.|..|...||
  Fly    63 MKDGSQKRKSYVVKTMLESD------KGGKAVNEMRYFHKEQQMYSTYLPQFEKIYRVAGHPVQL 121

  Fly   128 YVNCI-YHSLEPHQVLIFEDLAEMGYIVL-RDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFL 190
            ...|: ...::.:...|||||:...::.. |.:...::.:|....|||:.||.|:..:.....: 
  Fly   122 MPKCLEIGEIDGNIYFIFEDLSTRNFVAADRTKGVNMEHMRLSLRKLAELHAASVIYKERYGPY- 185

  Fly   191 ESYTHGLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFES--IKDDFLERL--VEEW-KD 250
                |..|:......|....:...|.|    |.||   ||...::  |.:.:|:..  .|:: |.
  Fly   186 ----HADFDNGFARKDKIEHSVRRFEV----KAPE---YKAAMKTWGIDECYLKNFPTTEQYGKL 239

  Fly   251 IRKSQKKD--EYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEP 313
            ..:|...|  ::.||.|||....||:||:.:..:..:.::|||||......|.|||..|.:....
  Fly   240 CLESLNVDPQDFNVLTHGDFSPSNILFKYNENGAPSEALILDFQICKWASPTQDLLMLIILSARK 304

  Fly   314 EHRWNNWDDLINYYISVLQDVLKKIGYKGVMPS----QSGLWKRLHQHKYYEFFLISTFLPLMWA 374
            :..:..:|:::..|...|.|.|:.:.||..:|.    ||.::|:  .:.:..||.:...||    
  Fly   305 DSSYKEFDNIVRIYWEYLIDFLRVLKYKKPLPQLRELQSAIYKK--NNTFSAFFAVMNHLP---- 363

  Fly   375 LRDKSVDFGDLL 386
                    ||||
  Fly   364 --------GDLL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 80/302 (26%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 80/302 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459737
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.