DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG10513

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster


Alignment Length:420 Identity:116/420 - (27%)
Similarity:200/420 - (47%) Gaps:36/420 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKY--TNRKGEFQKSLII 80
            ||||:..::.|:|...:.:..:::.||...||:||||:|||:|.|.|:.:  :..|....:..|:
  Fly    16 PEWLDETYLERLLRDLKNDPGLRITDLVIKPATAKGDNYASVMTRVRILFLKSGAKSPETEYYIV 80

  Fly    81 KTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCIYHSLEPHQVLIFE 145
            ||..|.:.....:.....:..|||.:|.|:||:...::.:.....:::...::...| |:.:|||
  Fly    81 KTTYENDAFASGIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFAKTLHVDYE-HEAIIFE 144

  Fly   146 DLAEMGYIVLRDR--DATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTHGLFEMPHVLNDPF 208
            |||...| ||.||  ...|:..|....||||.||.:..:...||..|..:.||:|........| 
  Fly   145 DLAVTKY-VLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGLLTKFDHGIFNRHTQAFAP- 207

  Fly   209 MRTGMEFFVELLG------KE-PEL-NKYKPYFESIKDDFLERLVEEWKDIRKSQKKDEYWVLCH 265
                  |||..:|      :| ||| .:|....:.::    ||::|....:...|..| :..|.|
  Fly   208 ------FFVNTVGVAADFARECPELGERYATKLKKLQ----ERVMEYSTRVYDPQPGD-FNTLVH 261

  Fly   266 GDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISV 330
            ||..:.|:|.::.:.....|..|:|||..:......||.|.....::.:.|:...|.|..||.:|
  Fly   262 GDYWVNNVMLRYGENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDALFQYYHTV 326

  Fly   331 LQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLMWAL---RDKSVDFGDLLQNEEKR 392
            |.:.||.:.:.|.:|:......:|.:.:   ||.::..|.....|   ::...||..|::::|:.
  Fly   327 LVETLKDLNFGGYIPTLRQFVLQLERGR---FFAVTVALVCQAILTNDQNADADFNALMKDDERG 388

  Fly   393 ---RKCSFSKGYIKE-VTILLARLDQLGLL 418
               ||..::...::: :...|.|.|:.|||
  Fly   389 RNFRKVLYTNKRLQDNLKRELPRFDRSGLL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 86/299 (29%)
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 86/299 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459576
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.