DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG11878

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster


Alignment Length:414 Identity:110/414 - (26%)
Similarity:184/414 - (44%) Gaps:22/414 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTNR--KGEFQKSLII 80
            |.||.||::...|.....::::|:..|...||.|.|.:|.|:|.|..|:||.:  ||:...:.::
  Fly    13 PVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLV 77

  Fly    81 KTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEF-ERILRQVGDDTQLYVNCIYHSLEPHQVLIF 144
            ||.........|:|....::..||.:|..:||:. :.:.:::.|..:|:...:....| ...:||
  Fly    78 KTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATMNVDRE-RDSIIF 141

  Fly   145 EDLAEMGY-IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPE-FLESYTHGLFEMPHVLNDP 207
            ||::...| :..|.:...|:....:..|||.:||.|..:...||. |.::|..|.|........|
  Fly   142 EDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNKHTRAYAP 206

  Fly   208 FMRTGMEFFVELLGKEPEL-NKYKPYFESIKDDFLERLVEEWKDIRK---SQKKDEYWVLCHGDL 268
            .|...:|.....|..:.|| .:||..        ::||||...|..:   :....::..|.||||
  Fly   207 IMTNLLEALSRSLASDEELGQRYKAK--------IDRLVERLMDYGERSTTSSPGDFLTLAHGDL 263

  Fly   269 HLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQD 333
            ...|.||::.......:.:.:|||.|.......||.|.....|:...|..:..:|:.:|...|.:
  Fly   264 WTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYRLTE 328

  Fly   334 VLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLMWALRDKSVDFGDLLQNEEK--RRKCS 396
            .|:|:.|.|.:||......:.....:|..|....|.|:|.....:......:|.:.|.  |.|.|
  Fly   329 ALRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEGKEDASIEQVLSSSESGMRFKNS 393

  Fly   397 F--SKGYIKEVTILLARLDQLGLL 418
            .  |:...|::::.|..|||.|||
  Fly   394 VYESENIKKKLSVTLPFLDQFGLL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 76/296 (26%)
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 76/296 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.