DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG6908

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:425 Identity:92/425 - (21%)
Similarity:171/425 - (40%) Gaps:97/425 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QNNQFND------DELVP--PEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFR 62
            |..|.||      |..:.  |.||:.:....:|| .:.....|:......|.:.||::|.:::.|
  Fly    28 QRQQVNDMVRETEDIAIEPIPAWLDQQKFEPILE-RDFPDLKKIKSFRLEPTAGKGENYTTLLLR 91

  Fly    63 ARVKYTNRKGEFQK-SLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQ 126
            |..:.....|..|. |.:.|.:|.: |:::::.... :|..|...|.:.:||||::.:..|....
  Fly    92 ANFELELNDGSEQSISYMAKILPNS-GNRENVASWK-VFYKERNTYGQYIPEFEQMYKDAGKKIS 154

  Fly   127 LYVNCIYHSLE-PHQVLIFEDLAEMGY--------IVLRDRDATLDEIRRIYFKLAKWHAVS--- 179
            .........:| ..::::.|||.:.|:        :.::..:|||:       |||::||.|   
  Fly   155 FGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLE-------KLAQFHAASAVR 212

  Fly   180 LKVQNEQPE-----------------------FLESYTHGLFEMPHVLNDPFMRTGMEFFVELLG 221
            .:::...||                       :::::.  |::..|:.||          |:..|
  Fly   213 FELKGSYPEEYNQNLCSVVDSLKELRENQLKAYIDAFP--LYDASHLTND----------VQAYG 265

  Fly   222 KEPE--LNKYKPYFESIKDDFLERLVEEWKDIRKSQKKDEYWVLCHGDLHLRNIMFKHKDTVSLE 284
            .:.:  ...:.|..|.                       |:.||.|||....|||:::.:...|.
  Fly   266 SQADDMFQSFAPKIEG-----------------------EFRVLNHGDAWCNNIMYQYDEAGKLA 307

  Fly   285 DCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSG 349
            :...:|.|:|.......||||.|....|.:.:...:|.||.:|...|.:.||.:.|...:||...
  Fly   308 EVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRS 372

  Fly   350 LWKRLHQHKYYEFFLISTFLPLMWALRDKSVDFGD 384
            |.:.:..:..:...::|..|||:      .:|.||
  Fly   373 LHQSIFIYGDWILPIVSILLPLV------LIDGGD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 69/325 (21%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 69/325 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.