DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG5644

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster


Alignment Length:366 Identity:85/366 - (23%)
Similarity:144/366 - (39%) Gaps:66/366 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GNPQNNQFNDDELVPPEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKY 67
            |....||:.:         |:|.:.::...::| .:..:..:..|..|:.||:|.|::.|..:..
  Fly    25 GYDGTNQYEE---------NAEHLRQLFSQSKL-VSFSIAHIACSAGSSSGDNYMSVVKRVTISQ 79

  Fly    68 TNR------KGEFQKSLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQ 126
            ..:      .|....::|:|.. .|...::.:......|..|:..|..:.|     |.......|
  Fly    80 AGKDQDPELAGSEIVTVIVKRQ-IASLSRRQLYRCEEAFSNEINAYRHLAP-----LLAAHSRHQ 138

  Fly   127 LYVNCIYHSLEPHQ---------VLIFEDLAEMGYIVLRDRDATLD--EIRRIYFKLAKWHAVSL 180
            |:..|  |..|...         :::.:||..||: .::||.|.|:  :...:..|||:.||.||
  Fly   139 LFPVC--HIAESQDRRDAEGGEPIIVLQDLKAMGF-RMKDRLAGLELSDCLLVMKKLAQLHAASL 200

  Fly   181 KVQNEQPEFLESYTHGLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESI----KDDFL 241
            ..|.     |||.:.. |...|:....:.....:|:..:|.     ...:...||:    .||.|
  Fly   201 AAQE-----LESSSFA-FHADHLQEIVYCDEATDFYATILD-----TSVQQALESLGDANADDCL 254

  Fly   242 E---RLVEEWKDIRKSQKKDEY--------WVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISN 295
            .   ||:||.:.......|.|.        .|:|||||.:.||||:.:.    |:.:..|.|...
  Fly   255 TTPIRLLEELRTNLFENLKHEINATAAAPNSVICHGDLWVNNIMFRSEP----EEVIFFDLQAMR 315

  Fly   296 LFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLK 336
            .....||:|:.||.......|..:.|.|:..|...|.:.|:
  Fly   316 KSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 77/317 (24%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 77/316 (24%)
P-loop_NTPase <357..435 CDD:304359 85/366 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.