DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and JhI-26

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:408 Identity:88/408 - (21%)
Similarity:167/408 - (40%) Gaps:60/408 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EWLNSEFMARVLEGNEL-----EAAVKVIDLTFSPASAKGD---HYASIM----FRARVKYTNRK 71
            :||....:..:|....|     |:.|    .||.......|   |..:.|    :|..:.:....
  Fly     9 QWLRYTVLPSILRNGRLVDNYSESKV----TTFHVGDIDIDVIGHSEAFMLTFCYRTTINFEYDG 69

  Fly    72 GEFQKSLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCIYHSL 136
            .:||:.:::|..|.......:.:...|:|..|:..||::||||::..    |.........|..|
  Fly    70 QKFQRKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQKFT----DGKFAAPKYYYGEL 130

  Fly   137 EPHQ-VLIFEDLAEMGYIVLRDR-DATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTHGLFE 199
            ..|. |.|.|:.||.|:.|.:|| ..:|.........|.::|..:..::::.||.....|..|.|
  Fly   131 NQHSAVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFHGFAYAMKHKNPEKFAQLTDNLKE 195

  Fly   200 MPHVLND---PFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLER---LVEEWKDIRKSQ--K 256
            ..:. ||   |..:..|:..::...|  .:..|:|   .|.::|:::   ::.::....:.:  .
  Fly   196 SRYA-NDNIHPEWKLTMKTSIDRAAK--AVATYQP---QIDEEFVKKFCFMISDYSQYGRQRVAP 254

  Fly   257 KDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWD 321
            ::....|||||....|:.:::.|....::.|:.|:|...:.....||...:.:.:..|.|..|::
  Fly   255 REPLATLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFE 319

  Fly   322 DLINYYISVLQDVLKKIGYKGVMP---SQSGLWKRLHQHKYYEFFLISTFL-----PL------M 372
            .:...|...|.:..::.. |..:|   |:..|.|...:...|...:.::||     ||      |
  Fly   320 AIFCEYTLALHNSYREHA-KEEVPDFLSRGELLKEYVRFLPYSLSISASFLMSLVDPLDISPEEM 383

  Fly   373 WALRDKSVDFGDLLQNEE 390
            :||:         |.:||
  Fly   384 FALQ---------LSDEE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 64/304 (21%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 61/285 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.