DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG9498

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster


Alignment Length:435 Identity:124/435 - (28%)
Similarity:203/435 - (46%) Gaps:48/435 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NDDELVPPEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTN--RKGE 73
            |:..:..||:||..|....||....|:.|.:.::.|:..|..||:|.|.::|..|.:..  ..||
  Fly     6 NEQNISVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADGGE 70

  Fly    74 F----QKSLIIKTMP--EAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCI 132
            .    |.|||:||:|  ||....:|:.    :|..|...||.|||..:.:.|  ||   .:....
  Fly    71 SPVTEQLSLIVKTIPITEATQFLEDVC----VFIKEKQTYTDVLPRLDILSR--GD---TFGAKY 126

  Fly   133 YHSLE-PHQVLIFEDLAEMGY-IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTH 195
            |||:: |.|.::|.||...|: :..|::....:....|..:|.|:||.|:.:..:.|..::.||.
  Fly   127 YHSVKTPVQTIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTR 191

  Fly   196 GLFEMPHVL-NDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLERLVEEWK----DIRKSQ 255
            |:.....:: :|.|.:....|...|:........|    |.| ...|:||::.::    |..:.:
  Fly   192 GMLSEDILMKSDTFEQMFGGFLKGLIKSSASWAGY----EKI-SKHLQRLMDNFRNVCADAPRPR 251

  Fly   256 KKDEYWVLCHGDLHLRNIMFKHKDTVSLED----CMLLDFQI----SNLFPLTFDLLYSIYMLLE 312
            |.|.|.||.||||...|.|:.: |..|..|    .:.:|||:    |....|.|.|..||.:.|.
  Fly   252 KGDRYVVLNHGDLWTNNFMYGY-DNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLL 315

  Fly   313 PEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLMWALRD 377
            .|.|    ::||..|.:..:|.|:...::.: ||...|...|...:.|..|.:..|||::...::
  Fly   316 QERR----EELIKVYYASFKDALEYARFEDI-PSYEDLQYELRSRETYGLFGMFAFLPMITMPKE 375

  Fly   378 KSVDFG-DLLQNEE-KRRKCS--FSKGYIKE-VTILLARLDQLGL 417
            .:.|.. :.:|:|. |:||..  ||:.::.: ....|.|.|.||:
  Fly   376 LAQDNSIENMQDEAFKQRKMDAIFSQKFLNDHQKWALKRADSLGV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 90/310 (29%)
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 90/310 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459300
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.