DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG33510

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:400 Identity:89/400 - (22%)
Similarity:156/400 - (39%) Gaps:83/400 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGNPQNNQF---NDDELVPPEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDH------Y 56
            ||..|.:..|   |..||...|..| :.:|.:| .::.|..| :::....||:   :|      |
  Fly     1 MSTEPYSPVFTRENRTELFTLEECN-KILANLL-ADKNEQGV-LLNFNIVPAT---EHTGFLGEY 59

  Fly    57 ASIMFRARVKYTNRKGEFQKSLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQV 121
            ..:.|:.:::  ::|......|.:|::.....:.:..:....:.|.|:.|| .:|.|.::..:.|
  Fly    60 FHLYFQYQLE--DQKDVQTSRLFVKSVIFQNANMEFYMEKMGLIEKEIKLY-DLLNELKKFSKHV 121

  Fly   122 GDDTQLYVNCIYHSLEPHQVLIFEDLAEMGYIVLRDRDATLDE--IRRIYFKLAKWHAVSLKVQN 184
            ..     ..|.:...:   :.:.:::.:|||:.|......|:|  :..|...||..||.|:..:.
  Fly   122 WS-----AKCYFTRKD---LFVMQNVEDMGYVALPPGTRFLNENQMGPILKSLATLHASSIAYEK 178

  Fly   185 EQ------------------PEFLESYTHGLFEM-------PHVLNDPFMRTGMEFFVELLGKEP 224
            :|                  || :|.||.||..:       |.||::                 |
  Fly   179 QQGKTIGVEFRKWLKEVSVDPE-VEWYTTGLRAVLAVAAIHPDVLDN-----------------P 225

  Fly   225 ELNKYKPYFESIKDDFLERLVEEWKDIRKSQKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLL 289
            |..:|      |..:....|.:.:..:..|......:|  |.|....|: |.||:....|..:|:
  Fly   226 EAQEY------IAQELPRCLDKVYCMVNPSPVHRNVFV--HRDAWNANV-FYHKEKPHEERSILV 281

  Fly   290 DFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRL 354
            |||:....|...|.....|:.|||..|......||..|...|.:..:::   ||.|.|..|.|:.
  Fly   282 DFQLCRYSPPAMDFHLVTYLNLEPFSRKKMIGSLIETYYDALAEEFREM---GVNPYQEQLSKQE 343

  Fly   355 HQHKYYEFFL 364
            .:....:|.|
  Fly   344 FEQSLNDFSL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 66/320 (21%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 52/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459881
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.