DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG5126

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:455 Identity:95/455 - (20%)
Similarity:172/455 - (37%) Gaps:105/455 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VIDL--TFSPASAKGDH----------YASIMFRARVKYTNRKGEFQKSLIIKTMPEAEGHKKDM 93
            |.|:  .|.|:::...|          :.|.::...:.....:.:..:.:::|.|...|..::. 
  Fly    16 VYDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFMKGTEEFRES- 79

  Fly    94 LGGSPI-FETEMGLYTKVLPEFERILRQVGDDTQL---YVNCIYHSLEPH---------QVLIFE 145
             ..|.| |..|:..|.::||.:|.:||....::::   :|.|.|.:...|         .||..:
  Fly    80 -SNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALK 143

  Fly   146 DLAEMGY-----IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTHGLFEMPHV-- 203
            .|...||     :.||     .|::..:...:..:||:....:..||........|:.:||.|  
  Fly   144 HLKGDGYQLGPRLTLR-----RDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSS 203

  Fly   204 ----LNDPFMRTGMEFFVELLGKEPE--LNKYKPYFESIKDDFLERLVEEW--------KDIRKS 254
                :.|...|...:.|.|...::.|  |....|.|.:.    :|||.|::        :.||.|
  Fly   204 SGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAA----IERLREKYFKQPTLLLERIRTS 264

  Fly   255 -----QKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPE 314
                 |....:....|||.:..|::|.:.....::....:|||.........||.:.:||....|
  Fly   265 SFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSE 329

  Fly   315 HRWNNWDDLINYY----ISVLQDVLKKIGYKGVMPS-------QSGLWKRLHQH-KYYEFF---L 364
            .|...:.||:..|    |.:|:.||::  .:..:..       |...::|.:.| |.|.|:   :
  Fly   330 GRKEIYADLLRKYHRSMIEMLELVLRR--NRNELTDDRVDQLLQEYSFERFNAHFKRYAFYGPMV 392

  Fly   365 ISTFLPLMW----------------------ALRDKSVDFGDLLQNEE--KRRKCSFSKGYIKEV 405
            ...|||  |                      |....|:|......|:|  |..:.::..||:.|:
  Fly   393 CMHFLP--WLLGTEKDCAELSRLFETDMHGPAFHQLSLDIAGDEANQEIFKTVRHAYEHGYMDEI 455

  Fly   406  405
              Fly   456  455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 72/340 (21%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 69/322 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.