DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG31099

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:443 Identity:103/443 - (23%)
Similarity:193/443 - (43%) Gaps:84/443 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VP--PEWLNS----EFMARVLE-GNELEAAVKVIDLTFSPASAKGDHYASIMFR-------ARVK 66
            ||  |:|::|    :.:..||| |.::.:.:..:.|              |.||       .:||
  Fly     3 VPKIPDWVSSLSLNQAVHSVLEDGVQITSVIPSVHL--------------IQFRNCTVLLPIQVK 53

  Fly    67 YTNRKGEFQKSLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNC 131
            ...|....:|...:.........:..::....:|:.|..:|..|||:.|.|.|:||...      
  Fly    54 VQLRDFTMKKLFFLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKV------ 112

  Fly   132 IYHSLEPH----------QVLIFEDLAEMGYIVLRDRDATLDE--IRRIYFKLAKWHAVSLKVQN 184
               |..|.          |.::.|||....|..: :|.|..::  ::::..|||::||.|.....
  Fly   113 ---SFGPRAFRLDYSIGVQYVLLEDLKAKSYKNV-ERQAGFNKLCLKQVLKKLAQFHAASAVCVE 173

  Fly   185 EQPEFLESYTHGLF-----EMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLERL 244
            :...|.....:|::     .:...||||      |.|:.      :|.:::     :.|.|.:||
  Fly   174 KHGAFSNLLVNGVYTKANESVLQELNDP------EIFLS------QLRRWR-----LGDHFHKRL 221

  Fly   245 VEEWKDI------RKSQKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDL 303
            ||:.||:      ..|...:|:.||.|.|..:.|:|||..|:..:||..|||:|:........||
  Fly   222 VEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDL 286

  Fly   304 LYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTF 368
            .|:|....|.:.:...:|:::.||...|.|.||.:.:.|.:|....:...|:::....:.:::..
  Fly   287 YYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRA 351

  Fly   369 LPLMWALRDKSVDFGDLLQNEEKRRKCSF--SKGYIKEVTILLARLDQLGLLH 419
            ||:  .:.::..|  ::.:....:.||:.  |:.||:.:..:|..:::..||:
  Fly   352 LPI--TMMNQFED--EVNERYASKMKCAMFTSRKYIQAIKDILPWMEERSLLN 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 79/317 (25%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 76/305 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459807
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.