DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG1561

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:369 Identity:84/369 - (22%)
Similarity:158/369 - (42%) Gaps:71/369 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QNNQFNDDELVPPEWLNSEFMARVLE--GNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYT 68
            |.:....||.:|.|.: ::|:.:::.  ..||.|..   :|....||||||:|..:::|.:.   
  Fly   213 QEDTAKPDEDLPNEQV-TQFLRQLVSQLWPELGANP---ELRLERASAKGDNYLGVVWRLQA--- 270

  Fly    69 NRKGEFQKSLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERI---LRQVGDDTQLYVN 130
              ..:.::||::|..|:....:|... ..|.|..|...|...||....|   .:.:|||     .
  Fly   271 --ASDSKRSLVVKLPPQNRVRRKQFF-ARPCFLRETAAYEVFLPLTALIQDKWKIIGDD-----R 327

  Fly   131 CIYHSL-------EPHQVLIFEDLAEMGYIVLRDR--DATLDEIRRIYFKLAKWHAVSLKVQNEQ 186
            ...|:|       ||::.::.|||:..|: .|.:|  |.:::.:||:....||.||:||..:.:.
  Fly   328 FRQHALCFGTRQDEPNECIVLEDLSCAGF-SLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQL 391

  Fly   187 PEFLESYTHGLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLERLVEEWKDI 251
            ||.::.                    ::..|::..:..:.:....|||::|:..|..|:....|.
  Fly   392 PEKMQQ--------------------LQQLVDIFEQRRDDHALGVYFENLKESALSALLAPADDA 436

  Fly   252 RKSQKK---------------------DEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISN 295
            .:.:.:                     :.:.|:||||....||::|..:...|||..|:|:|:..
  Fly   437 YRVRLEAYFARGSYFELLLPLVSGFNCEPFAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMR 501

  Fly   296 LFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKKIG 339
            ......||.|.::.......|..:.::::..|...|...|.::|
  Fly   502 YASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEELGLQLIRLG 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 71/321 (22%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 71/321 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459915
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.