DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG31975

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:382 Identity:77/382 - (20%)
Similarity:142/382 - (37%) Gaps:114/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KVIDLTFSPASAKGDHYASIMFRARVKYTNRKGE-FQKSLIIKTMPEAEGHKKDMLGGSPIFE-- 101
            ::::...|..:..||:|.|::.....:.....|| |::.|:.|..|....:.:       .|:  
  Fly    24 RLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPKYWQ-------FFQPE 81

  Fly   102 ----TEMGLYTKVLPEFERILRQVG--DDTQL-----YVNCIYHSLEPHQ-------VLIFEDLA 148
                ||..:|..:.|....:..:.|  |::|.     :..| ..|||.:.       ||:.|:|.
  Fly    82 QTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGC-RESLESNSSKVDQNAVLVLENLR 145

  Fly   149 EMGYIV---LRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTHGLFEMPHVLNDPFMR 210
            ..||:.   |:..|.....:...|  :|::||:||.::..:||.........|            
  Fly   146 SSGYVSGQRLKAFDLAHTLLALKY--MAEFHALSLALRILRPEVFREQVRPFF------------ 196

  Fly   211 TGMEFFVELLGKEPELNKYKPYFESI-KDDFLERLVEEWKDIRKSQKKDEYWV------------ 262
                       |:.:.:...|.::|: |.:.||       |||::...|...|            
  Fly   197 -----------KKFDWHAEAPEWKSVMKAETLE-------DIRRATNNDSRLVARMKELSDQFFE 243

  Fly   263 ---------------LCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFD----LLYSI- 307
                           :.|.|..:.||||::..|.:..:..::|||.:....:..|    ||.|: 
  Fly   244 FLAAAPDRPDGPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVD 308

  Fly   308 YMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFL 364
            ..:||.|     ::.::..|....:..|:::|.|            |..|.:.||.|
  Fly   309 TAILEVE-----FEHMLEAYYEAFERCLRRVGAK------------LEVHTFKEFRL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 69/344 (20%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 69/343 (20%)
APH <214..329 CDD:279908 25/126 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459648
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.