DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG31288

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:411 Identity:115/411 - (27%)
Similarity:182/411 - (44%) Gaps:54/411 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NDD------ELVPPEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTN 69
            |||      .|:.|:|:|.::...||..:|.: .|||:..|...|...|:::.|.|.|..:|...
  Fly     4 NDDIVNPNEHLIIPDWINEKYFESVLAKDEPD-HVKVLKFTVVAAIPPGENFTSTMLRVYIKLEM 67

  Fly    70 RKGEFQ-KSLIIKTM-PEAEGHKKDMLGGSPI-----FETEMGLYTKVLPEFERILRQVGDDTQL 127
            :.|..: |:.|.||| ||..       |||.|     |..|..:|...||.||.:.:.||.|.||
  Fly    68 KDGSVKTKTYIFKTMLPEER-------GGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQL 125

  Fly   128 YVNCIYHSLEPHQV-LIFEDLAEMGYIVLRDRDAT----LDEIRRIYFKLAKWHAVSL---KVQN 184
            ...|::.......: .|||||....:   ::.|.|    ::.:.:...|||::||.|.   ::..
  Fly   126 APKCLHTEEREGDIHFIFEDLCVKRF---KNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHG 187

  Fly   185 EQP-EFLESYTHGLFEMPHVLNDPFMRTGMEFFVELL--GKEPELNKYKPYFESIKDDFLERLVE 246
            ..| ||.|.:.....:..||  |.|......:...:|  |.: :.:||...|.::|        :
  Fly   188 PYPSEFSEGFVKKDVKKFHV--DGFQLKEKAYKKAMLSWGLK-DADKYIKAFPTVK--------Q 241

  Fly   247 EWKDIRKSQK--KDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYM 309
            .|.....:.:  .||:.||.|||....|:|..:....:||..:|:||||........|||:  ::
  Fly   242 YWAQCLSTLELNPDEFHVLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLF--FL 304

  Fly   310 LLEPEH--RWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLH--QHKYYEFFLISTFLP 370
            .|.|.:  |...:|..:..|...|.:.||.:..|..:|....|...::  .|.:|.||.|...||
  Fly   305 TLSPTNDLRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNHLP 369

  Fly   371 LMWALRDKSVDFGDLLQNEEK 391
            ::....||..:..:|..|.|:
  Fly   370 IILFPTDKDSNIHNLSANTEE 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 85/309 (28%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 83/303 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459730
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.