DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and CG2004

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:405 Identity:90/405 - (22%)
Similarity:165/405 - (40%) Gaps:62/405 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FSPASAKGDHYASIMFRARVKYTNRKGE-------FQKSLIIKTMPEAEGHKKDMLGGSPIFETE 103
            |.|:..|||.|.|.:||..: |..::.|       .:.|:|:|.||: ..|::.:......|..|
  Fly    36 FGPSGKKGDAYLSRVFRITI-YGVKEAEEGQDEKQLEISVIVKAMPD-NLHRRRLFRSVIFFRNE 98

  Fly   104 MGLYTKVLPEFERI--LRQVGDDTQL--YVNCIYHSLE-PHQVLIFEDLAEMGY-IVLRDRDATL 162
            :..||||||..|..  .||.......  |..|:....: .:..:..||:...|| ..:|....:|
  Fly    99 INFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISL 163

  Fly   163 DEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTHGLFEMPHVLNDPFMRTGMEFFVELLGKEPELN 227
            ::.......|.::|.|:|.......:..|.....|.|..:..:.....||.....|.:..:....
  Fly   164 EDALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENVATDAVKQ 228

  Fly   228 KY-KPYFESIKDDFLE-RLVEEWKDIRKSQKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLD 290
            .| ...:|::..:||: .|.::..::..::.|  ..|..|||....|.:.|:.:....|:.:::|
  Fly   229 IYPNSKYETVATNFLQPPLFDDLINLVSTRSK--LSVFGHGDCWTPNFLTKYNERGQSEEIIIID 291

  Fly   291 FQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGL-WKRL 354
            ||::....|..||.:.||.....|.|..::|:|:..|:...||:::.:|..    ::|.: |:.|
  Fly   292 FQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGN----AESIISWESL 352

  Fly   355 HQHKYYEFFLISTF-----------LPLMWALRDKSVDFGDLLQN----------------EEKR 392
            .:.       :..|           ||:.....|:..|...:.:|                :::|
  Fly   353 QEE-------LKNFGRFGCGMGIESLPMTMMEDDEVADLDGIKENAILTDIWNITPFKESAKQQR 410

  Fly   393 R----KCSFSKGYIK 403
            .    |.:..:||||
  Fly   411 LADIFKHAIDQGYIK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 72/302 (24%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 72/301 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.